KEGG   Staphylococcus epidermidis ATCC 12228: SE0272Help
Entry
SE0272            CDS       T00110                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sep00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271394..272638
Genome map
AA seq 414 aa AA seqDB search
MLSAQQFLKEFNNVESLNESLYEIVSHICEEVKLQGDKALKNYNLQFDQVETEKLELEQS
QLKNAYDMLDNETRDALEQSYQRIKVYQENIKVKQESSQQTECYERYHPIERVGIYVPGG
KASYPSTVLMTATLAQVAGVNEITVVTPPQNNGICQEVLAACYITGVHHVYQVGGAQSIA
ALTYGTETIKKVDKIVGPGNQYVAYAKKFVFGQVGIDQIAGPTEIALIIDESADLDAIAY
DVFAQAEHDEMACTYVISENEKVLNQLNTIIQEKLQYVERQDIISQSIANHHYLILAQDT
EEACLIMNTIAPEHASIQTRAPEMYIDKVKYVGALFLGHFSPEVIGDYMAGPSHVLPTNQ
TARFTNGLSVNDFMTRHSVIHLSQKTFNEVAESAEHIAHIESLFNHEKSIHVRR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcgcacaacaatttttaaaagaatttaataatgttgaatctctaaatgaatct
ttgtacgagatagtgagtcacatttgtgaagaagttaaattacagggagataaagcttta
aaaaattataatttacaatttgatcaagtggaaactgagaagcttgaattagagcaaagc
caactaaaaaatgcatacgacatgctagataatgaaacacgagatgcattagagcaaagc
tatcagagaattaaagtgtaccaagaaaatattaaggtaaaacaggaatcatctcaacaa
actgaatgttatgaacgataccatcctatcgaacgtgtaggtatttacgtgccgggaggt
aaggctagctatccgtctacagtattaatgactgcaacacttgctcaagtagcaggtgtt
aatgagattactgttgttaccccacctcaaaataacggtatatgtcaagaggtgttagcc
gcttgttacattacaggtgttcatcatgtttatcaagtcggcggagcacaaagtattgca
gcgctaacttatggcacggaaactataaaaaaagtcgacaaaatcgtaggtccagggaat
caatatgttgcttatgctaaaaagtttgtattcggtcaagtaggcatagaccaaatcgca
ggaccgacagaaatagccttgattatagacgaaagtgctgacttagacgcaatcgcttat
gacgtatttgcacaagcagaacatgatgaaatggcttgtacttatgtgattagtgaaaat
gaaaaggtacttaatcaattgaacactataatacaagagaaacttcagtatgttgaacgg
caagatatcatatcacaaagtattgctaaccatcattatctaatattagctcaagatact
gaagaagcatgtttaattatgaacacgattgcacctgaacatgcatctattcaaactcga
gcacctgaaatgtatatagataaagttaaatatgtaggcgcactttttttaggtcatttt
tctcctgaagttattggggactatatggcaggtccaagtcatgtacttcctactaatcaa
acagctagatttacaaatgggctttctgtgaatgactttatgacacgacattcagtcatt
catttatcacaaaaaacatttaacgaagtggcagaatcagctgagcatattgcacatata
gaatctttatttaatcatgaaaaatcgattcatgtacgccgataa

DBGET integrated database retrieval system