KEGG   Staphylococcus epidermidis ATCC 12228: SE0272Help
Entry
SE0272            CDS       T00110                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE0272
  Amino acid metabolism
   00340 Histidine metabolism
    SE0272
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SE0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271394..272638
Genome map
AA seq 414 aa AA seqDB search
MLSAQQFLKEFNNVESLNESLYEIVSHICEEVKLQGDKALKNYNLQFDQVETEKLELEQS
QLKNAYDMLDNETRDALEQSYQRIKVYQENIKVKQESSQQTECYERYHPIERVGIYVPGG
KASYPSTVLMTATLAQVAGVNEITVVTPPQNNGICQEVLAACYITGVHHVYQVGGAQSIA
ALTYGTETIKKVDKIVGPGNQYVAYAKKFVFGQVGIDQIAGPTEIALIIDESADLDAIAY
DVFAQAEHDEMACTYVISENEKVLNQLNTIIQEKLQYVERQDIISQSIANHHYLILAQDT
EEACLIMNTIAPEHASIQTRAPEMYIDKVKYVGALFLGHFSPEVIGDYMAGPSHVLPTNQ
TARFTNGLSVNDFMTRHSVIHLSQKTFNEVAESAEHIAHIESLFNHEKSIHVRR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcgcacaacaatttttaaaagaatttaataatgttgaatctctaaatgaatct
ttgtacgagatagtgagtcacatttgtgaagaagttaaattacagggagataaagcttta
aaaaattataatttacaatttgatcaagtggaaactgagaagcttgaattagagcaaagc
caactaaaaaatgcatacgacatgctagataatgaaacacgagatgcattagagcaaagc
tatcagagaattaaagtgtaccaagaaaatattaaggtaaaacaggaatcatctcaacaa
actgaatgttatgaacgataccatcctatcgaacgtgtaggtatttacgtgccgggaggt
aaggctagctatccgtctacagtattaatgactgcaacacttgctcaagtagcaggtgtt
aatgagattactgttgttaccccacctcaaaataacggtatatgtcaagaggtgttagcc
gcttgttacattacaggtgttcatcatgtttatcaagtcggcggagcacaaagtattgca
gcgctaacttatggcacggaaactataaaaaaagtcgacaaaatcgtaggtccagggaat
caatatgttgcttatgctaaaaagtttgtattcggtcaagtaggcatagaccaaatcgca
ggaccgacagaaatagccttgattatagacgaaagtgctgacttagacgcaatcgcttat
gacgtatttgcacaagcagaacatgatgaaatggcttgtacttatgtgattagtgaaaat
gaaaaggtacttaatcaattgaacactataatacaagagaaacttcagtatgttgaacgg
caagatatcatatcacaaagtattgctaaccatcattatctaatattagctcaagatact
gaagaagcatgtttaattatgaacacgattgcacctgaacatgcatctattcaaactcga
gcacctgaaatgtatatagataaagttaaatatgtaggcgcactttttttaggtcatttt
tctcctgaagttattggggactatatggcaggtccaagtcatgtacttcctactaatcaa
acagctagatttacaaatgggctttctgtgaatgactttatgacacgacattcagtcatt
catttatcacaaaaaacatttaacgaagtggcagaatcagctgagcatattgcacatata
gaatctttatttaatcatgaaaaatcgattcatgtacgccgataa

DBGET integrated database retrieval system