KEGG   Staphylococcus epidermidis ATCC 12228: SE0325Help
Entry
SE0325            CDS       T00110                                 

Definition
(RefSeq) deoxypurine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00230  Purine metabolism
sep00240  Pyrimidine metabolism
sep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SE0325
   00240 Pyrimidine metabolism
    SE0325
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SE0325
    2.7.1.76  2'-deoxyadenosine kinase
     SE0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_17 AAA_33 AAA_15 AAA_28 TsaE RsgA_GTPase ABC_tran Cytidylate_kin2 AAA_25 AAA_22 ATPase RNA_helicase MMR_HSR1 Cytidylate_kin AAA_14 AAA_29 NB-ARC AAA_16 NACHT AAA PRK NTPase_1 GTP_EFTU ATP_bind_1 PduV-EutP ArgK
Motif
Other DBs
NCBI-GeneID: 1056830
NCBI-ProteinID: NP_763880
UniProt: A0A0H2VF06
Position
complement(328194..328856)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAVITIAGTVGVGKSTLTQALADKLNFKTSFENVDHNPYLDKFYHNFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEQGTMSADDYHTYYELFN
AMVMTPYFPKPDVLIYLECDYDEVIDRIQQRGRDMEINTDPEYWRKLFKRYENWINNFNA
CPVVRLNINEYDIHEDLDSLDPVIDKIAQVIKAYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattatggtattcctcaaaatgcagtaataaccattgctggtactgtaggggtt
ggtaaatctacgttaacacaagcacttgctgataagttaaattttaaaacttcctttgag
aatgtagaccataatccttatttagataaattttatcataattttgaacgttggagcttt
catcttcaaatttactttcttgctgaacgttttaaggaacaaaaacgcatgtttgagtat
ggtggaggtttcgttcaagatcgttcaatttatgaggatgtagatatttttgcaaaaatg
catgaagaacaaggaacaatgagtgctgacgactatcacacgtattacgaattatttaat
gcaatggtcatgacaccttattttccaaagcctgatgttctaatttatctagaatgtgat
tatgatgaagtaattgatcgtattcaacagcgtggacgtgacatggaaatcaatacagat
ccagaatattggagaaaactatttaaacggtatgaaaattggattaacaattttaatgca
tgtcctgttgttcgacttaatattaatgaatatgacatacacgaagatttagactccctt
gatccagtcattgataaaattgctcaagttattaaagcataccgacaagtggatacaaga
taa

DBGET integrated database retrieval system