KEGG   Staphylococcus epidermidis ATCC 12228: SE0375Help
Entry
SE0375            CDS       T00110                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SE0375 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0375 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SE0375 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SE0375 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SE0375 (adhA)
   00626 Naphthalene degradation
    SE0375 (adhA)
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SE0375 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373594..374616
Genome map
AA seq 340 aa AA seqDB search
MKAAVVTKDHRVSIEEKRLRELRPGEALVKTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGRVIKIADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVLNAGYTVDGAMAEE
VIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGIEPGQWLGVFGVGGLGNLALQY
AKNVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVNRLTNNKGLDATVITAVA
KTPFNQAVDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIEVVGSLVGTRQDLREAFQFAA
ENKVIPKIQLRQLSEINDIFDEMEKGTITGRMVIDMKSTH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtagtaaccaaagatcatagagtaagtattgaagaaaaacgtttaaga
gaattaagacctggagaagcattagtaaagactgaatattgtggtgtatgtcatactgat
ttacatgttaaaaatgcagatttcggtgacgtaacaggtgtaacattaggacatgaagga
attggacgtgtcattaaaattgctgataacgtagattcattaaaggtaggggatcgtgta
tctatagcatggatgtatgcagcatgtggtaattgtgagtattgcacaactggtagagaa
acattatgcagggatgtccttaatgccggatatactgttgatggggcaatggctgaagaa
gtcattgttgatgcgaattatgcagttaaagttcccgaaaatcttgatccagcggctgct
tcatctattacctgtgcaggtgtgacaacatataaagcagtaaaagtgagtggtatcgaa
ccaggacaatggttaggcgtatttggtgtgggaggattaggtaatttagcattgcaatac
gccaaaaacgtaatgggcgcgaaagtcgttgcatttgacattaatgatgataaattaaat
tttgctaaagagcttggtgctgatgcaatcataaattcaactaatgttgatcctattgag
gaagttaatcgtctaacgaataataaaggattagatgcaacggtgattactgctgtagct
aaaacaccttttaatcaagcagttgatgttgttaaggcgggtgcacgtgtggtagcagta
ggacttccagtagataaaatggatttagatattccacgtttagtgcttgatggaattgaa
gtcgttggttcattagttggtaccagacaagatttaagagaagcatttcaatttgctgcc
gaaaataaagttattcctaaaatccaattaagacaattatctgaaattaacgatattttt
gatgaaatggaaaaaggaacaattacgggtcgaatggtaattgatatgaaaagcacgcac
tga

DBGET integrated database retrieval system