KEGG   Staphylococcus epidermidis ATCC 12228: SE0559Help
Entry
SE0559            CDS       T00110                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sep00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sep00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555880..556641
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNELPTLPDPKEVESVICAPTIQLDALVTAVKDGKAKG
LKIGAQNAYFEESGAYTGETSPVALSELGVKYVVIGHSERRDYFHETDEEVNKKAHAIFN
HGMTPIICVGESDEEREAGKANKIVGNQVKKAVEGLSDDQLKEVVIAYEPIWAIGTGKSS
TSEDANEMCAHVRQTLADLSSQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagccggaaactggaaaatgaataaaacagttcaagaagctaaa
gactttgtaaacgaattaccaacattacctgatcctaaagaagtagaatcagttatttgt
gcaccaacaatccaattagacgctttagtaacagctgttaaagatggtaaagcaaaaggg
ttaaaaattggagcacaaaacgcttactttgaagaaagcggtgcttatactggagaaact
tcaccagtagcattatctgaattaggtgttaaatatgtagtgattggtcactcagagcgt
cgtgactatttccacgaaactgacgaagaagtaaacaaaaaagcgcatgctatcttcaat
cacggtatgacacctattatttgtgtaggtgaatctgatgaagaacgtgaagctggtaaa
gcaaataaaatcgtaggtaatcaagtgaaaaaagctgtcgaaggtttatcagatgatcaa
cttaaagaagttgttattgcatatgaaccaatttgggctatcggtactggtaagtcatct
acatctgaagatgcaaatgaaatgtgtgctcacgtacgtcaaacattagctgacttatct
agtcaagaggttgctgacgctacacgtattcaatatggtggtagtgttaaacctaataac
attaaagaatatatggctcaatcagatatcgatggcgctcttgtaggtggcgcatcatta
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system