KEGG   Staphylococcus epidermidis ATCC 12228: SE0559Help
Entry
SE0559            CDS       T00110                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE0559 (tpiA)
   01230 Biosynthesis of amino acids
    SE0559 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0559 (tpiA)
   00051 Fructose and mannose metabolism
    SE0559 (tpiA)
   00562 Inositol phosphate metabolism
    SE0559 (tpiA)
Enzymes [BR:sep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SE0559 (tpiA)
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SE0559 (tpiA)
  Exosomal proteins of bladder cancer cells
   SE0559 (tpiA)
  Exosomal proteins of melanoma cells
   SE0559 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555880..556641
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNELPTLPDPKEVESVICAPTIQLDALVTAVKDGKAKG
LKIGAQNAYFEESGAYTGETSPVALSELGVKYVVIGHSERRDYFHETDEEVNKKAHAIFN
HGMTPIICVGESDEEREAGKANKIVGNQVKKAVEGLSDDQLKEVVIAYEPIWAIGTGKSS
TSEDANEMCAHVRQTLADLSSQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagccggaaactggaaaatgaataaaacagttcaagaagctaaa
gactttgtaaacgaattaccaacattacctgatcctaaagaagtagaatcagttatttgt
gcaccaacaatccaattagacgctttagtaacagctgttaaagatggtaaagcaaaaggg
ttaaaaattggagcacaaaacgcttactttgaagaaagcggtgcttatactggagaaact
tcaccagtagcattatctgaattaggtgttaaatatgtagtgattggtcactcagagcgt
cgtgactatttccacgaaactgacgaagaagtaaacaaaaaagcgcatgctatcttcaat
cacggtatgacacctattatttgtgtaggtgaatctgatgaagaacgtgaagctggtaaa
gcaaataaaatcgtaggtaatcaagtgaaaaaagctgtcgaaggtttatcagatgatcaa
cttaaagaagttgttattgcatatgaaccaatttgggctatcggtactggtaagtcatct
acatctgaagatgcaaatgaaatgtgtgctcacgtacgtcaaacattagctgacttatct
agtcaagaggttgctgacgctacacgtattcaatatggtggtagtgttaaacctaataac
attaaagaatatatggctcaatcagatatcgatggcgctcttgtaggtggcgcatcatta
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system