KEGG   Staphylococcus epidermidis ATCC 12228: SE0564Help
Entry
SE0564            CDS       T00110                                 

Definition
carboxyesterase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SE0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560831..561571
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSADVRQLGRYLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDVLDGYDYLVDQGYEEIAVAGLSLGGAFALKLSLNRDVKGIITMCAPMEN
KTEGSIYEGFLEYARNFKKYEGKDQQTIDQEMEQFHPTETLRELSDTLNGVKEHVDEVID
PILVVQAEQDTMIDPQSANYIYNHVDSDEKEIKWYQHSGHVITIDKEKEKVFEDVYQFLE
SLEWTE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaactaccaaaaccattcttttttgaagaagggaaacgtgcagtgttactt
cttcacggctttacaggtaactctgctgatgtaagacaacttgggcgttatcttcaaaaa
aagggctatacatcttatgctccacaatatgaaggacatgcagcacccccagaagaaata
ttaaaatctagcccttttgtttggtttaaagatgttttagatggttatgattatttagta
gatcaaggttacgaagaaatagcagtagctggtttatcattaggtggcgccttcgcatta
aaactaagtttaaatcgtgatgtgaaggggattataactatgtgtgcacctatggagaat
aaaacagaaggttcgatttatgaaggctttcttgaatatgcacgtaactttaaaaaatat
gaaggcaaagatcaacaaacgattgatcaagaaatggaacaatttcatccaactgaaacc
ctgagagaactgagtgacactctaaatggagttaaagaacatgtcgatgaagtaattgat
ccaatacttgtcgtacaagcagaacaagatacaatgattgatcctcaatcagcaaattat
atatataatcatgtcgattctgatgaaaaagaaatcaaatggtatcaacattcaggtcat
gtgattaccattgataaagaaaaagagaaagtctttgaagatgtatatcaatttttagaa
tcattggaatggacagagtaa

DBGET integrated database retrieval system