KEGG   Staphylococcus epidermidis ATCC 12228: SE0564Help
Entry
SE0564            CDS       T00110                                 

Definition
(RefSeq) carboxyesterase-like protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SE0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Peptidase_S9 Abhydrolase_6 BAAT_C Abhydrolase_3 DUF2048 FSH1 Chlorophyllase Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 1057787
NCBI-ProteinID: NP_764119
UniProt: A0A0H2VF93
Position
560831..561571
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSADVRQLGRYLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDVLDGYDYLVDQGYEEIAVAGLSLGGAFALKLSLNRDVKGIITMCAPMEN
KTEGSIYEGFLEYARNFKKYEGKDQQTIDQEMEQFHPTETLRELSDTLNGVKEHVDEVID
PILVVQAEQDTMIDPQSANYIYNHVDSDEKEIKWYQHSGHVITIDKEKEKVFEDVYQFLE
SLEWTE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaactaccaaaaccattcttttttgaagaagggaaacgtgcagtgttactt
cttcacggctttacaggtaactctgctgatgtaagacaacttgggcgttatcttcaaaaa
aagggctatacatcttatgctccacaatatgaaggacatgcagcacccccagaagaaata
ttaaaatctagcccttttgtttggtttaaagatgttttagatggttatgattatttagta
gatcaaggttacgaagaaatagcagtagctggtttatcattaggtggcgccttcgcatta
aaactaagtttaaatcgtgatgtgaaggggattataactatgtgtgcacctatggagaat
aaaacagaaggttcgatttatgaaggctttcttgaatatgcacgtaactttaaaaaatat
gaaggcaaagatcaacaaacgattgatcaagaaatggaacaatttcatccaactgaaacc
ctgagagaactgagtgacactctaaatggagttaaagaacatgtcgatgaagtaattgat
ccaatacttgtcgtacaagcagaacaagatacaatgattgatcctcaatcagcaaattat
atatataatcatgtcgattctgatgaaaaagaaatcaaatggtatcaacattcaggtcat
gtgattaccattgataaagaaaaagagaaagtctttgaagatgtatatcaatttttagaa
tcattggaatggacagagtaa

DBGET integrated database retrieval system