KEGG   Staphylococcus epidermidis ATCC 12228: SE0608Help
Entry
SE0608            CDS       T00110                                 

Definition
aminotransferase NifS-like protein
Orthology
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Selenocompound metabolism
Thiamine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:sep00450]
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:sep00730]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595110..596351
Genome map
AA seq 413 aa AA seqDB search
MAEHSFDVKAVIKDFPILEQKVNNKRLAYLDSTATSQTPVQVLNVLDDYYKRYNSNVHRG
VHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINIVAHSYGDANISEGDEIV
VTEMEHHANIVPWQQLAKRKNATLKFIPMTKDGELQLDDIKATINDKTKIVAIAHVSNVL
GTINDVKTIAKIAHEHGAVISVDGAQSAPHMALDMQDIDADFYSFSGHKMLGPTGIGVLY
GKRELLQNMEPVEFGGDMIDFVSKYDSTWADLPTKFEAGTPLIAQAIGLAEAIHYIENLG
FNAIHQHEKELTEYAYEQMLTIDGLEIYGPPKDRRAGVITFNLADIHPHDVATAVDTEGV
AVRAGHHCAQPLMKWLGVSSTARASFYVYNTKEDVDQLVQALKQTKEFFSYEF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacattcttttgatgtcaaggcagtcattaaagactttccgatacttgagcaa
aaggtaaataataaacgtttagcataccttgattcaactgcgactagccaaacacctgta
caagttttaaatgtactagatgattactacaaacgctataattctaatgtccatcgtggt
gtacacacattagggtctttagctacagatggctatgaaaatgcaagagaaacagtaaga
cgttttatcaatgcgaagtactttgaagaaattattttcactcgaggaacaactgcatca
ataaatatagtagcacatagttatggtgacgctaatattagtgagggtgacgaaattgtt
gtaacagaaatggaacatcatgctaatattgttccatggcaacaattagctaaacgtaaa
aatgcaacactaaaatttattccaatgacaaaagatggtgaattgcaattagatgatata
aaagcaaccatcaatgataaaactaaaattgttgctatcgcacacgtttccaatgtttta
ggaacaattaatgatgttaaaactatcgctaaaattgcacatgaacatggtgcagttata
agtgtggatggtgcgcaatcagctccacacatggctttagatatgcaagatatcgatgct
gatttttatagttttagtggacataaaatgttaggtcctactggcattggagttttatat
ggaaaaagagaattattacaaaatatggaacccgttgaatttggtggagatatgatagac
ttcgtaagtaaatatgactccacttgggctgacctaccaactaaatttgaggctggcaca
ccacttattgctcaagcaataggtttagcagaagctatacattatattgaaaatttaggt
tttaatgcgattcatcagcatgaaaaagaattgacagaatatgcatatgaacaaatgtta
actatagatggtcttgaaatttacggtccaccaaaagatagacgtgcaggggtcattact
tttaatttagcagatatacatccacatgatgtagctacagctgttgatacagaaggtgtt
gcagttcgtgcaggccatcactgtgcgcaacctttgatgaaatggttaggtgtctcttca
acagcacgtgcaagtttttacgtttataatacgaaagaagatgtagatcaattagttcaa
gcattgaaacaaacgaaggagtttttctcttatgaattttaa

DBGET integrated database retrieval system