KEGG   Staphylococcus epidermidis ATCC 12228: SE0608Help
Entry
SE0608            CDS       T00110                                 

Definition
aminotransferase NifS-like protein
Orthology
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SE0608
Enzymes [BR:sep01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SE0608
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     SE0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595110..596351
Genome map
AA seq 413 aa AA seqDB search
MAEHSFDVKAVIKDFPILEQKVNNKRLAYLDSTATSQTPVQVLNVLDDYYKRYNSNVHRG
VHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINIVAHSYGDANISEGDEIV
VTEMEHHANIVPWQQLAKRKNATLKFIPMTKDGELQLDDIKATINDKTKIVAIAHVSNVL
GTINDVKTIAKIAHEHGAVISVDGAQSAPHMALDMQDIDADFYSFSGHKMLGPTGIGVLY
GKRELLQNMEPVEFGGDMIDFVSKYDSTWADLPTKFEAGTPLIAQAIGLAEAIHYIENLG
FNAIHQHEKELTEYAYEQMLTIDGLEIYGPPKDRRAGVITFNLADIHPHDVATAVDTEGV
AVRAGHHCAQPLMKWLGVSSTARASFYVYNTKEDVDQLVQALKQTKEFFSYEF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacattcttttgatgtcaaggcagtcattaaagactttccgatacttgagcaa
aaggtaaataataaacgtttagcataccttgattcaactgcgactagccaaacacctgta
caagttttaaatgtactagatgattactacaaacgctataattctaatgtccatcgtggt
gtacacacattagggtctttagctacagatggctatgaaaatgcaagagaaacagtaaga
cgttttatcaatgcgaagtactttgaagaaattattttcactcgaggaacaactgcatca
ataaatatagtagcacatagttatggtgacgctaatattagtgagggtgacgaaattgtt
gtaacagaaatggaacatcatgctaatattgttccatggcaacaattagctaaacgtaaa
aatgcaacactaaaatttattccaatgacaaaagatggtgaattgcaattagatgatata
aaagcaaccatcaatgataaaactaaaattgttgctatcgcacacgtttccaatgtttta
ggaacaattaatgatgttaaaactatcgctaaaattgcacatgaacatggtgcagttata
agtgtggatggtgcgcaatcagctccacacatggctttagatatgcaagatatcgatgct
gatttttatagttttagtggacataaaatgttaggtcctactggcattggagttttatat
ggaaaaagagaattattacaaaatatggaacccgttgaatttggtggagatatgatagac
ttcgtaagtaaatatgactccacttgggctgacctaccaactaaatttgaggctggcaca
ccacttattgctcaagcaataggtttagcagaagctatacattatattgaaaatttaggt
tttaatgcgattcatcagcatgaaaaagaattgacagaatatgcatatgaacaaatgtta
actatagatggtcttgaaatttacggtccaccaaaagatagacgtgcaggggtcattact
tttaatttagcagatatacatccacatgatgtagctacagctgttgatacagaaggtgtt
gcagttcgtgcaggccatcactgtgcgcaacctttgatgaaatggttaggtgtctcttca
acagcacgtgcaagtttttacgtttataatacgaaagaagatgtagatcaattagttcaa
gcattgaaacaaacgaaggagtttttctcttatgaattttaa

DBGET integrated database retrieval system