KEGG   Staphylococcus epidermidis ATCC 12228: SE0793Help
Entry
SE0793            CDS       T00110                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00020  Citrate cycle (TCA cycle)
sep00620  Pyruvate metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0793
   00020 Citrate cycle (TCA cycle)
    SE0793
   00620 Pyruvate metabolism
    SE0793
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SE0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 DUF896 ATP-synt_ab_Xtn HTH_17
Motif
Other DBs
NCBI-GeneID: 1056530
NCBI-ProteinID: NP_764348
UniProt: Q8CT13
Position
785219..786520
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFIKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVL
VDEGTVAVVGDVIVKIDAPDAEEMQFKGHGDDEDSKKEEKEQESPVQEEASSTQSQEKTE
VDESKTVKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSVAS
ESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIA
ADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgtt
aaatggtttattaaagccggcgatacaattgaagaagatgatgtattagcagaagttcaa
aatgataaatctgtagtagaaattccttctccagtaagtggtactgttgaagaagtgtta
gtagatgaaggaacagtggcagtagtaggagatgtcatcgttaaaattgatgcacctgat
gcagaagaaatgcaatttaaaggtcatggcgatgatgaggattctaagaaagaagaaaaa
gaacaagaatcaccagtgcaagaagaagcttcatcaactcaatcacaagaaaagacagaa
gtagatgaaagtaaaactgttaaagcgatgccgtcagtgcgtaagtatgcacgtgaaaat
ggtgtcaatattaaagctgtaaatggttctggtaaaaatggacgaatcacaaaagaagac
atcgatgcatacttaaatggtggtagttccgaagaaggttcaaacactagcgtagcatct
gaatcaacttctagtgatgtcgttaatgcttctgcaacacaagcattaccagaaggcgac
ttccctgaaactacagaaaaaatacctgcaatgcgcaaagcaattgctaaagcaatggtt
aattctaaacacactgcacctcatgttacattaatggatgaaattgatgtgcaagaatta
tgggatcaccgtaagaaatttaaagaaattgctgctgaacaaggtacaaaacttactttc
ttaccatatgttgttaaagcattagtttctgcacttaaaaaatatccagcacttaatact
tctttcaatgaagaagctggagaggttgtacacaaacattactggaatattggtattgct
gcagatacggataaaggattattagtaccagtagttaaacatgccgatcgtaaatcaata
ttcgaaatttctgatgaaattaatgaactagctgtaaaagcacgtgatggtaaattaact
tcagaagaaatgaaaggtgcaacatgcacaattagtaatatcggttccgctggtggacaa
tggttcactccagttatcaatcacccagaagtagctatcttaggaattggccgtatcgct
caaaaacctatcgttaaagatggagaaattgtagctgcaccagtgttagctttatcatta
agctttgaccatagacaaatcgatggtgctactggacaaaatgctatgaatcacattaaa
cgcttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system