KEGG   Staphylococcus epidermidis ATCC 12228: SE0793Help
Entry
SE0793            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE0793
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0793
   00020 Citrate cycle (TCA cycle)
    SE0793
   00620 Pyruvate metabolism
    SE0793
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SE0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785219..786520
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFIKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVL
VDEGTVAVVGDVIVKIDAPDAEEMQFKGHGDDEDSKKEEKEQESPVQEEASSTQSQEKTE
VDESKTVKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSVAS
ESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIA
ADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgtt
aaatggtttattaaagccggcgatacaattgaagaagatgatgtattagcagaagttcaa
aatgataaatctgtagtagaaattccttctccagtaagtggtactgttgaagaagtgtta
gtagatgaaggaacagtggcagtagtaggagatgtcatcgttaaaattgatgcacctgat
gcagaagaaatgcaatttaaaggtcatggcgatgatgaggattctaagaaagaagaaaaa
gaacaagaatcaccagtgcaagaagaagcttcatcaactcaatcacaagaaaagacagaa
gtagatgaaagtaaaactgttaaagcgatgccgtcagtgcgtaagtatgcacgtgaaaat
ggtgtcaatattaaagctgtaaatggttctggtaaaaatggacgaatcacaaaagaagac
atcgatgcatacttaaatggtggtagttccgaagaaggttcaaacactagcgtagcatct
gaatcaacttctagtgatgtcgttaatgcttctgcaacacaagcattaccagaaggcgac
ttccctgaaactacagaaaaaatacctgcaatgcgcaaagcaattgctaaagcaatggtt
aattctaaacacactgcacctcatgttacattaatggatgaaattgatgtgcaagaatta
tgggatcaccgtaagaaatttaaagaaattgctgctgaacaaggtacaaaacttactttc
ttaccatatgttgttaaagcattagtttctgcacttaaaaaatatccagcacttaatact
tctttcaatgaagaagctggagaggttgtacacaaacattactggaatattggtattgct
gcagatacggataaaggattattagtaccagtagttaaacatgccgatcgtaaatcaata
ttcgaaatttctgatgaaattaatgaactagctgtaaaagcacgtgatggtaaattaact
tcagaagaaatgaaaggtgcaacatgcacaattagtaatatcggttccgctggtggacaa
tggttcactccagttatcaatcacccagaagtagctatcttaggaattggccgtatcgct
caaaaacctatcgttaaagatggagaaattgtagctgcaccagtgttagctttatcatta
agctttgaccatagacaaatcgatggtgctactggacaaaatgctatgaatcacattaaa
cgcttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system