KEGG   Staphylococcus epidermidis ATCC 12228: SE0978Help
Entry
SE0978            CDS       T00110                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SE0978 (glpK)
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SE0978 (glpK)
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SE0978 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
987025..988524
Genome map
AA seq 499 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNKEGEIKGVSQREFKQHFPHPGWVEHDANEIWTSVLSVMA
ELLNENNINANQIEGIGITNQRETTVVWDKNTGRPIYHAIVWQSRQTQDICTNLKEQGYE
ETFREKTGLLLDPYFAGTKVKWILDHVEGAREKAENGDLLFGTIDSWLVWKLSGRTAHIT
DYTNASRTLMFNIYDLKWDDELLELLNIPKQMLPEVKESSEIYGKTIDYHFFGQEVPIAG
IAGDQQAALFGQACFDRGDVKNTYGTGGFMLMNTGEEAVKSESGLLTTIAYGLDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQTENYASRVESTEGVYMVPAFVGLGTPYWDSEAR
GAIFGLSRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIEVQNLRVDGGAVKNNFIMQF
QADIVNSSVERPEIQETTALGAAYLAGLAVGFWDDKEDIRERWKLQTEFKPEMDEDQRHK
LYSGWKKAVKATQVFKLED
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatcaattgatcaaggaactacgagttcacgtgcgatacttttt
aataaagaaggagaaattaaaggtgtttctcaaagagaatttaaacaacactttccacat
ccaggctgggtagaacatgatgctaatgaaatatggacatctgttctatcagttatggct
gagttacttaatgaaaacaatattaatgcaaatcaaattgaaggtattggtattacaaac
caacgtgaaacgacagttgtatgggataaaaatacaggtcgtccaatctatcacgctatc
gtttggcaatcacgtcagacacaagatatttgtacaaatttaaaggaacagggttatgaa
gaaacatttagagaaaaaacaggtttacttttagacccgtactttgcgggaactaaagta
aaatggattcttgatcatgttgaaggtgctagagaaaaagctgaaaatggtgatttactc
ttcggaacaatcgattcatggttagtatggaaattgtcaggacgtactgctcatattaca
gattacactaatgcaagtcgtacattaatgtttaatatttatgacctaaaatgggatgat
gagttgttagaacttttaaatattcctaaacaaatgttacctgaagttaaagaatcaagt
gaaatttacgggaaaactatcgactatcacttctttggtcaagaagtacctattgctggt
attgccggtgaccaacaagcagcattatttggtcaagcatgttttgaccgtggtgatgta
aaaaatacatacggcacaggtggatttatgctaatgaatactggtgaagaagcagttaag
tcagaaagtggcttgttaacaaccattgcatacggtttagatggaaaagttaattatgca
cttgaaggttcaattttcgtatctggttctgctatccaatggctacgagatggtttgaga
atgattaattctgcgccacaaaccgaaaactatgcttcaagagtagagtcaactgagggt
gtttatatggttccagcatttgttggtttaggtacaccttattgggattcagaagcaaga
ggtgctattttcggattatctcgtggtacggaaaaagaacatttcattcgtgctacatta
gaatctttgtgctatcaaacaagagatgttatggaagctatgtctaaggactcaggtatt
gaagttcaaaatttacgcgttgatggtggtgctgtaaaaaataacttcattatgcagttc
caagcagatatcgtaaattcatctgttgaaagacctgaaatccaagaaacaacagcactt
ggtgctgcatatttagctggattagctgttggattctgggatgataaagaggatatccgt
gaacgttggaaacttcaaactgagttcaaaccagaaatggatgaagatcaacgtcataaa
ctttatagtggttggaaaaaagctgttaaggcgactcaagtatttaaattagaagattaa

DBGET integrated database retrieval system