KEGG   Staphylococcus epidermidis ATCC 12228: SE1010Help
Entry
SE1010            CDS       T00110                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE1010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SE1010
Enzymes [BR:sep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SE1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015492..1016556
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLVKEFKEYLPVNQSTPALTLNEGHTPLIYCENLSQKLDIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAEENDEIELVNSVNPFRIEGQKTGAFEIVEQLDGQA
PDILAIPVGNAGNITAYWQGFVEYHNKKNTQLPQMFGFQAEGASPIVQNKIIKNPETIAT
AIRIGNPASWQKAVNALDESNGLIDSVTDEEILEAYQLMTTNEGVFSEPASNASIAGLIK
LHRSGKLPKGKKIVAILTGNGLKDPDTAISLLDNPIQPLPNNKESIIRYIKGAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagttaaagaatttaaagaatatttaccagtcaatcaatct
acaccagcactaacactcaatgaaggacatacaccacttatttattgtgaaaatctttct
caaaaattagatattgaattatatgttaaatatgaaggagcaaatccgactggctcattt
aaagatcgtggtatggttatggctgtaacaaaggcaaaagaacaagggaaaaaagttgtt
atttgtgcttccactggtaatacttcagcatcagcagctgcttatgctgcaagagctggt
ttaaaagcaattgtcgtaattcctgaaggtaaaatagcattaggtaaattatcacaagca
gttatgtatggtgcagaaattgtttctatagaaggaaacttcgatgaagcactagaaatt
gtaaaagagattgctgaagaaaatgatgaaattgaattagttaattctgttaatccattt
aggattgaaggacaaaagacgggtgcctttgaaattgttgaacagttagatggtcaagcc
cctgacattttagcaataccagtgggaaatgcaggtaatataactgcttattggcaagga
tttgttgaatatcataataaaaagaatacacaattaccacaaatgtttggcttccaagca
gaaggagcatctccaattgttcaaaataaaataatcaaaaatccagaaacaatagctaca
gctatccgaatagggaatcctgctagttggcaaaaagctgttaatgcactagatgaatca
aatggtttaattgatagtgtgacagatgaagaaattttagaagcttatcagttaatgaca
acaaatgaaggtgtttttagtgaaccagcgagtaatgcttcaattgcaggtctaatcaaa
cttcatcgctctggtaagttacctaaaggtaaaaagatagttgcaatattaactgggaat
ggacttaaagatcctgacacagctatttctctcttagataatcctattcaacctttacct
aataataaagaaagtataattagatacatcaaaggggcaatctag

DBGET integrated database retrieval system