KEGG   Staphylococcus epidermidis ATCC 12228: SE1010Help
Entry
SE1010            CDS       T00110                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE1010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SE1010
Enzymes [BR:sep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SE1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015492..1016556
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLVKEFKEYLPVNQSTPALTLNEGHTPLIYCENLSQKLDIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAEENDEIELVNSVNPFRIEGQKTGAFEIVEQLDGQA
PDILAIPVGNAGNITAYWQGFVEYHNKKNTQLPQMFGFQAEGASPIVQNKIIKNPETIAT
AIRIGNPASWQKAVNALDESNGLIDSVTDEEILEAYQLMTTNEGVFSEPASNASIAGLIK
LHRSGKLPKGKKIVAILTGNGLKDPDTAISLLDNPIQPLPNNKESIIRYIKGAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagttaaagaatttaaagaatatttaccagtcaatcaatct
acaccagcactaacactcaatgaaggacatacaccacttatttattgtgaaaatctttct
caaaaattagatattgaattatatgttaaatatgaaggagcaaatccgactggctcattt
aaagatcgtggtatggttatggctgtaacaaaggcaaaagaacaagggaaaaaagttgtt
atttgtgcttccactggtaatacttcagcatcagcagctgcttatgctgcaagagctggt
ttaaaagcaattgtcgtaattcctgaaggtaaaatagcattaggtaaattatcacaagca
gttatgtatggtgcagaaattgtttctatagaaggaaacttcgatgaagcactagaaatt
gtaaaagagattgctgaagaaaatgatgaaattgaattagttaattctgttaatccattt
aggattgaaggacaaaagacgggtgcctttgaaattgttgaacagttagatggtcaagcc
cctgacattttagcaataccagtgggaaatgcaggtaatataactgcttattggcaagga
tttgttgaatatcataataaaaagaatacacaattaccacaaatgtttggcttccaagca
gaaggagcatctccaattgttcaaaataaaataatcaaaaatccagaaacaatagctaca
gctatccgaatagggaatcctgctagttggcaaaaagctgttaatgcactagatgaatca
aatggtttaattgatagtgtgacagatgaagaaattttagaagcttatcagttaatgaca
acaaatgaaggtgtttttagtgaaccagcgagtaatgcttcaattgcaggtctaatcaaa
cttcatcgctctggtaagttacctaaaggtaaaaagatagttgcaatattaactgggaat
ggacttaaagatcctgacacagctatttctctcttagataatcctattcaacctttacct
aataataaagaaagtataattagatacatcaaaggggcaatctag

DBGET integrated database retrieval system