KEGG   Staphylococcus epidermidis ATCC 12228: SE1051Help
Entry
SE1051            CDS       T00110                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1051 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SE1051 (trpC)
Enzymes [BR:sep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SE1051 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062885..1063673
Genome map
AA seq 262 aa AA seqDB search
MTILNEIIEYKKTLLERKYYDKKLEILQDNGNVKRRKLIDSLNYDRTLSVIAEIKSKSPS
VPQLPQRDLVQQVKDYQKYGANAISILTDEKYFGGSFERLNQLSKITSLPVLCKDFIIDK
IQIDVAKRAGASIILLIVNILSDDQLKELYSYAINHNLEVLVEVHTIRELERAHQINPKI
IGVNNRDLKRFETDVLHTNKLLKFKKSNCCYISESGIHTKEDVEKIVDSNIDGLLVGEAL
MKTNDLSQFLPSLKLKKNLYDS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaaatgaaattattgagtataaaaaaactttgcttgagcgtaaatactat
gataaaaaacttgaaattttacaagataacggaaatgttaagaggagaaagctgattgat
tcacttaactatgatagaacattatcagttattgctgaaataaaatcgaaaagcccatct
gtacctcaattaccgcaacgtgatcttgttcaacaagttaaagattatcaaaaatatggt
gctaatgctatatcaatattaactgatgaaaaatactttggcggtagttttgaacgatta
aatcagttgtcaaagataacatcgttaccagttttatgtaaagattttattattgataaa
attcaaatagatgttgcaaaacgagctggtgcatctattattttattaatagtaaatatt
ttaagtgatgaccaattaaaagaattgtattcatatgcaataaaccataatttagaagtt
ctagtagaagttcatacaattagagaacttgaacgtgcacaccaaattaaccctaaaatt
attggtgttaataatcgtgatttaaaacgatttgaaaccgatgttctacatacaaataaa
ttacttaagtttaaaaagtctaattgctgctacatttcagagagtggcattcatacaaaa
gaagatgttgagaaaatagtagattcaaatattgacggtttacttgtaggggaggcatta
atgaaaacaaatgacttaagtcagtttttgcctagtttaaagttaaagaagaatctctat
gatagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system