KEGG   Staphylococcus epidermidis ATCC 12228: SE1051Help
Entry
SE1051            CDS       T00110                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01130  Biosynthesis of antibiotics
sep01230  Biosynthesis of amino acids
Module
sep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SE1051 (trpC)
Enzymes [BR:sep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SE1051 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth
Motif
Other DBs
NCBI-GeneID: 1057414
NCBI-ProteinID: NP_764606
UniProt: Q8CPB2
Position
1062885..1063673
Genome map
AA seq 262 aa AA seqDB search
MTILNEIIEYKKTLLERKYYDKKLEILQDNGNVKRRKLIDSLNYDRTLSVIAEIKSKSPS
VPQLPQRDLVQQVKDYQKYGANAISILTDEKYFGGSFERLNQLSKITSLPVLCKDFIIDK
IQIDVAKRAGASIILLIVNILSDDQLKELYSYAINHNLEVLVEVHTIRELERAHQINPKI
IGVNNRDLKRFETDVLHTNKLLKFKKSNCCYISESGIHTKEDVEKIVDSNIDGLLVGEAL
MKTNDLSQFLPSLKLKKNLYDS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaaatgaaattattgagtataaaaaaactttgcttgagcgtaaatactat
gataaaaaacttgaaattttacaagataacggaaatgttaagaggagaaagctgattgat
tcacttaactatgatagaacattatcagttattgctgaaataaaatcgaaaagcccatct
gtacctcaattaccgcaacgtgatcttgttcaacaagttaaagattatcaaaaatatggt
gctaatgctatatcaatattaactgatgaaaaatactttggcggtagttttgaacgatta
aatcagttgtcaaagataacatcgttaccagttttatgtaaagattttattattgataaa
attcaaatagatgttgcaaaacgagctggtgcatctattattttattaatagtaaatatt
ttaagtgatgaccaattaaaagaattgtattcatatgcaataaaccataatttagaagtt
ctagtagaagttcatacaattagagaacttgaacgtgcacaccaaattaaccctaaaatt
attggtgttaataatcgtgatttaaaacgatttgaaaccgatgttctacatacaaataaa
ttacttaagtttaaaaagtctaattgctgctacatttcagagagtggcattcatacaaaa
gaagatgttgagaaaatagtagattcaaatattgacggtttacttgtaggggaggcatta
atgaaaacaaatgacttaagtcagtttttgcctagtttaaagttaaagaagaatctctat
gatagttaa

DBGET integrated database retrieval system