KEGG   Staphylococcus epidermidis ATCC 12228: SE1053Help
Entry
SE1053            CDS       T00110                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sep00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sep00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064290..1065498
Genome map
AA seq 402 aa AA seqDB search
MKIQTEVDELGFFGEYGGQYVPETLMPAIIELKKAYEDAKSDTHFKKEFNYYLSEYVGRE
TPLTFAESYTKLLGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQH
GVASATIAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQGTLSDAVNKALQ
YWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEGRLPDALVACVGGGS
NSIGTFYPFIQDDVKLYGVEAAGKGSHTHNHALAIGKGKPGVLHGSKMYLIQNDDGQIEL
AHSISAGLDYPGIGPEHSYYNDIGRVSYVSATDNEAMEALITFSKVEGIIPAIESAHALS
YVEKLAPNMDEKEIIVVTISGRGDKDMETIKQYKENGGEQNE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaaacagaagtagatgaactgggctttttcggtgaatatggtggccaatat
gtacctgaaacattgatgccagctattattgaacttaaaaaagcatatgaggacgcgaaa
tcagatactcacttcaagaaagaatttaattattatttaagtgaatatgttggtagagaa
acgcctttaacatttgctgaatcatacacaaaattgttaggtggtgccaaaatatatctt
aaaagagaagacttaaatcacactggtgctcataaaattaataacgcgataggacaggca
ctattagctaaaaggatggggaaaactaaattagtagccgaaacaggtgctggtcaacat
ggtgtagcaagtgccaccatcgctgctttattcgatatggatcttattgttttcatggga
agtgaagatatcaaacgtcaacaacttaacgtatttagaatggaattgctaggagctaaa
gtagtgtctgtgtcagatgggcaaggaacactatcagatgcagtaaataaagctttgcaa
tattgggtgaatcatgtcgaggatacacattatttattaggctcagcgttgggacctgat
ccgtttccaactatggtcagagattttcagagtgtgattggtaatgaaattaaaagccaa
attttaagtaaagaaggacgacttccagatgcgttagtcgcgtgtgttggtggagggtcc
aattcaataggtacgttctatccatttatacaagatgacgttaaattatatggggtagaa
gctgcaggaaaaggaagtcatacgcacaatcatgctttagctatagggaaaggtaaacca
ggtgtattacatggttccaaaatgtaccttattcaaaatgatgatggacaaattgaattg
gcacactctatatcagcgggactagattatccaggtattggacctgaacattcgtattat
aatgatattggtcgtgtatcatatgtaagtgctacagataatgaagctatggaagcactt
ataacattctcaaaagttgaaggtatcattccagcaattgaaagtgcacatgcattgagt
tatgttgaaaaattagcgccaaatatggatgaaaaagaaattattgttgtgactatttca
ggtcgtggagataaagatatggaaacaattaaacaatacaaagaaaacggtggtgaacaa
aatgagtaa

DBGET integrated database retrieval system