KEGG   Staphylococcus epidermidis ATCC 12228: SE1053Help
Entry
SE1053            CDS       T00110                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1053
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE1053
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SE1053
Enzymes [BR:sep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SE1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064290..1065498
Genome map
AA seq 402 aa AA seqDB search
MKIQTEVDELGFFGEYGGQYVPETLMPAIIELKKAYEDAKSDTHFKKEFNYYLSEYVGRE
TPLTFAESYTKLLGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKTKLVAETGAGQH
GVASATIAALFDMDLIVFMGSEDIKRQQLNVFRMELLGAKVVSVSDGQGTLSDAVNKALQ
YWVNHVEDTHYLLGSALGPDPFPTMVRDFQSVIGNEIKSQILSKEGRLPDALVACVGGGS
NSIGTFYPFIQDDVKLYGVEAAGKGSHTHNHALAIGKGKPGVLHGSKMYLIQNDDGQIEL
AHSISAGLDYPGIGPEHSYYNDIGRVSYVSATDNEAMEALITFSKVEGIIPAIESAHALS
YVEKLAPNMDEKEIIVVTISGRGDKDMETIKQYKENGGEQNE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaaacagaagtagatgaactgggctttttcggtgaatatggtggccaatat
gtacctgaaacattgatgccagctattattgaacttaaaaaagcatatgaggacgcgaaa
tcagatactcacttcaagaaagaatttaattattatttaagtgaatatgttggtagagaa
acgcctttaacatttgctgaatcatacacaaaattgttaggtggtgccaaaatatatctt
aaaagagaagacttaaatcacactggtgctcataaaattaataacgcgataggacaggca
ctattagctaaaaggatggggaaaactaaattagtagccgaaacaggtgctggtcaacat
ggtgtagcaagtgccaccatcgctgctttattcgatatggatcttattgttttcatggga
agtgaagatatcaaacgtcaacaacttaacgtatttagaatggaattgctaggagctaaa
gtagtgtctgtgtcagatgggcaaggaacactatcagatgcagtaaataaagctttgcaa
tattgggtgaatcatgtcgaggatacacattatttattaggctcagcgttgggacctgat
ccgtttccaactatggtcagagattttcagagtgtgattggtaatgaaattaaaagccaa
attttaagtaaagaaggacgacttccagatgcgttagtcgcgtgtgttggtggagggtcc
aattcaataggtacgttctatccatttatacaagatgacgttaaattatatggggtagaa
gctgcaggaaaaggaagtcatacgcacaatcatgctttagctatagggaaaggtaaacca
ggtgtattacatggttccaaaatgtaccttattcaaaatgatgatggacaaattgaattg
gcacactctatatcagcgggactagattatccaggtattggacctgaacattcgtattat
aatgatattggtcgtgtatcatatgtaagtgctacagataatgaagctatggaagcactt
ataacattctcaaaagttgaaggtatcattccagcaattgaaagtgcacatgcattgagt
tatgttgaaaaattagcgccaaatatggatgaaaaagaaattattgttgtgactatttca
ggtcgtggagataaagatatggaaacaattaaacaatacaaagaaaacggtggtgaacaa
aatgagtaa

DBGET integrated database retrieval system