KEGG   Staphylococcus epidermidis ATCC 12228: SE1054Help
Entry
SE1054            CDS       T00110                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sep00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sep00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065491..1066222
Genome map
AA seq 243 aa AA seqDB search
MSKLFIPYIMGDLNFIHHLKTLTENGADIVEIGVPFSDPVADGPIIMKAGRNAIDEGSNI
KFIFDELIKNKNTISSKYVLMTYYNILSAYGEELFLDKCDEAGVYGLIIPDLPYELTKKF
KKDFYHHSVKIISLIAMTASDARIMQIAKNSEGFIYTVTMNATTGNSGEFHPDLKRKIEY
IKKVSKIPVVAGFGIKNPEHVKDIASVADGIVIGSEIVKRIEIDSRKEFITYIKSIRTTL
NSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattattcattccgtatattatgggtgatttaaattttattcatcatttaaaa
acattaactgagaatggagcagacattgttgaaattggtgtgccattttctgatcctgtt
gcagatggacctataatcatgaaagcagggcgcaacgctattgacgagggttcaaacatt
aaattcatttttgatgaattaataaaaaataaaaatactatttcatctaagtatgtatta
atgacttattataatattctaagtgcttatggagaagaattatttttggataagtgtgat
gaagctggtgtttatggtttaattattccagatttaccttacgaacttacaaaaaagttt
aaaaaagatttttatcatcattctgttaaaataatatcgttaattgccatgaccgcaagt
gatgctaggattatgcaaattgcaaagaactcagaaggatttatttacacggtaacaatg
aatgccacaacaggtaacagtggggagttccatccagatttaaagagaaaaattgaatat
ataaaaaaagtttcaaaaattcctgtggttgctggatttggtatcaaaaatcctgaacat
gttaaagatatagcgtccgttgcagatggtattgtaattggtagtgaaattgtaaaacgt
attgaaatagattcaagaaaagaatttatcacttatatcaaatcaataagaactacgttg
aattctttataa

DBGET integrated database retrieval system