KEGG   Staphylococcus epidermidis ATCC 12228: SE1302Help
Entry
SE1302            CDS       T00110                                 

Definition
deoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1329460..1331892)
Genome map
AA seq 810 aa AA seqDB search
MSDPTLFDYSMIKGTVDAILFQNTDNFYTVLKVDTIESNEKFDSMPTVVGFLPNVVEGDV
YTFKGQVVQHPRYGKQLKAETFEKELPQTKEAIISYLSSDLFKGIGKKTAQNIVNTLGEN
AINDILTRPEILESVPSLPKKKQKQIADQINANQESEKIMIRLHDLGFGPKLSMAIYQFY
MGDTLNVLDKNPYQLVYDIKGIGFNRADQLARNVGIEPHSPERLKAALLFTLEEECIKQG
HTYLPRTIVIETTQNLLNEDIEKPIETEQLLEIIDVLSEEKKLISEADQVSIPSLYYSEL
KSVQNLYRIKTNTSKLKEIEQSDLQIHIGDIESQNEVNYSASQKEALETAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYNEDDYPVVLAAPTGRASKRLHESTGLEAMT
IHRLIGWNQDTQPQDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLEAQIVFVGDEDQ
LPSVGPGQVFKDLIDSEIIPRVNLTEVYRQQDGSSIIDLAHRMKLNEPIDITKRYHDRSF
IRCGTNQIPDVVDKVVKSAVAKGYDMSDIQVLAPMYKGNAGIKRLNQVLQSILNPKQQDD
REIEFGEAVFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDLMELTHAYCTSIHKSQGSEFPIVIMPIVRQYYRMLQRPILYTGLTRAKQSLVLL
GEQEAFDIGLKTNGQIRLTQLNDLLKSYFGQNKDNLTTNKQTINEQKENNNHLDLKNEKE
NDIQLNESTIFQIDPMINMGEMTPYDFVER
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccctacactttttgattattcaatgatcaaaggtacagttgatgctatttta
tttcaaaatacggataatttttatactgttctaaaagtagatactatagaatcaaatgaa
aaatttgatagtatgccaactgtggtagggtttcttcccaatgtagttgaaggcgatgtt
tatacttttaaagggcaagtcgtacaacatccacgttatggtaagcaattaaaggctgaa
acatttgaaaaagaattacctcaaactaaagaagccattattagttacttatcaagtgat
ttatttaaaggcatcggtaaaaaaacggctcaaaacattgtaaatacactaggtgaaaat
gctataaatgatattttaactcgtccagaaatcttagaaagtgtacctagtttaccaaag
aagaaacaaaagcaaattgctgatcagattaatgcaaaccaagaatctgagaaaattatg
atacgtttacacgacctagggtttggtccgaaattatcaatggctatatatcagttctat
atgggtgatactttaaatgtcttagataaaaatccttaccaattagtatatgacattaaa
ggtattggttttaatagggctgaccaacttgctcgaaatgtcggtattgagccacattca
cctgaaagattaaaagcagcattattatttacgttagaagaagaatgtatcaaacaagga
catacatatctacctcgtacaattgttatagaaacaacacaaaatttactcaatgaagat
attgagaaaccaattgaaacagagcaattactagaaatcattgacgttttatcagaagag
aaaaaattaatatctgaagctgatcaggtatcaattccaagtttatactattcagaattg
aaaagtgtgcaaaacttataccgaattaaaacaaacacatctaaattaaaagaaatagaa
cagtctgatttacaaatacatattggtgatattgagtcacaaaatgaggttaattactct
gcctctcaaaaagaagcgcttgaaacagcaataaattctaaaattatgcttttaactggt
ggtccgggtaccggtaaaaccacagtcattaaaggtatagttgaattatatgcagaaata
catgggctctcgctcgattatgatgattacaatgaagatgattatccagtagtgttagct
gcacccactggtcgtgcttctaagcgccttcacgaatcgacaggtttagaagcaatgaca
attcatcgtttaatcggttggaaccaagatacacaaccacaggatattttagaaaatgag
atcaatgcaagactcattatcatcgatgaaatgtcaatggtagatacttggttgttccat
caatttttaagcgctgtgcctttagaagcacaaattgtatttgtcggagatgaagatcag
ttaccatcagtaggtccaggacaggtatttaaagaccttattgattctgaaataataccg
cgtgttaatcttaccgaagtatatcgtcagcaagatggttccagtattattgacttagct
caccgtatgaaattaaatgaacctatcgatattactaaacgttatcatgatcgtagtttt
attcgttgtggtacgaatcaaattccagacgttgttgataaagtagttaaaagcgctgta
gctaaaggctatgatatgagtgatatacaagttttggctcctatgtataaaggtaacgct
ggtattaagagacttaaccaagttctacaatctattcttaatccgaagcaacaagatgat
cgtgaaatagaatttggtgaagctgtgtttagaaaaggggataaagtacttcagttagtt
aatcgacctaatgataatatatttaatggggatataggtataatagtaggtatattttgg
gccaaagaaaatgctctaaataaggatgtgttagttgtagattttgaaggtaatgaaatt
acatttactaaacaagatttaatggaactaacacatgcatattgtacatctatccataaa
tcacaaggttcagaatttcctattgtaattatgcctattgttagacaatattataggatg
ttacaacgtcccattctttatacaggattaactagagctaaacaatcacttgttttgctt
ggtgaacaagaagcatttgatataggtttaaaaacaaatggacaaatacgattaacgcaa
ttaaatgatttgttaaaatcgtattttggacaaaacaaagataatttaactacaaataaa
caaacgattaacgaacaaaaagaaaataacaatcatctggatttgaaaaatgaaaaagaa
aatgatatccaattaaacgagtcgacaattttccaaatcgatccaatgattaatatgggg
gaaatgacgccatatgacttcgttgaacgttga

DBGET integrated database retrieval system