KEGG   Staphylococcus epidermidis ATCC 12228: SE1302Help
Entry
SE1302            CDS       T00110                                 

Definition
(RefSeq) deoxyribonuclease
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SE1302
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SE1302
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SE1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_12 T2SSE AAA HHH_5 HHH_3 AAA_22 AAA_16 Mg_chelatase AAA_14 Zeta_toxin AAA_29 UvrD_C AAA_18 Helicase_RecD TsaE AAA_28 ABC_tran RsgA_GTPase AAA_17 NTPase_1 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 1056234
NCBI-ProteinID: NP_764857
UniProt: A0A0H2VGI2
Position
complement(1329460..1331892)
Genome map
AA seq 810 aa AA seqDB search
MSDPTLFDYSMIKGTVDAILFQNTDNFYTVLKVDTIESNEKFDSMPTVVGFLPNVVEGDV
YTFKGQVVQHPRYGKQLKAETFEKELPQTKEAIISYLSSDLFKGIGKKTAQNIVNTLGEN
AINDILTRPEILESVPSLPKKKQKQIADQINANQESEKIMIRLHDLGFGPKLSMAIYQFY
MGDTLNVLDKNPYQLVYDIKGIGFNRADQLARNVGIEPHSPERLKAALLFTLEEECIKQG
HTYLPRTIVIETTQNLLNEDIEKPIETEQLLEIIDVLSEEKKLISEADQVSIPSLYYSEL
KSVQNLYRIKTNTSKLKEIEQSDLQIHIGDIESQNEVNYSASQKEALETAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYNEDDYPVVLAAPTGRASKRLHESTGLEAMT
IHRLIGWNQDTQPQDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLEAQIVFVGDEDQ
LPSVGPGQVFKDLIDSEIIPRVNLTEVYRQQDGSSIIDLAHRMKLNEPIDITKRYHDRSF
IRCGTNQIPDVVDKVVKSAVAKGYDMSDIQVLAPMYKGNAGIKRLNQVLQSILNPKQQDD
REIEFGEAVFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDLMELTHAYCTSIHKSQGSEFPIVIMPIVRQYYRMLQRPILYTGLTRAKQSLVLL
GEQEAFDIGLKTNGQIRLTQLNDLLKSYFGQNKDNLTTNKQTINEQKENNNHLDLKNEKE
NDIQLNESTIFQIDPMINMGEMTPYDFVER
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccctacactttttgattattcaatgatcaaaggtacagttgatgctatttta
tttcaaaatacggataatttttatactgttctaaaagtagatactatagaatcaaatgaa
aaatttgatagtatgccaactgtggtagggtttcttcccaatgtagttgaaggcgatgtt
tatacttttaaagggcaagtcgtacaacatccacgttatggtaagcaattaaaggctgaa
acatttgaaaaagaattacctcaaactaaagaagccattattagttacttatcaagtgat
ttatttaaaggcatcggtaaaaaaacggctcaaaacattgtaaatacactaggtgaaaat
gctataaatgatattttaactcgtccagaaatcttagaaagtgtacctagtttaccaaag
aagaaacaaaagcaaattgctgatcagattaatgcaaaccaagaatctgagaaaattatg
atacgtttacacgacctagggtttggtccgaaattatcaatggctatatatcagttctat
atgggtgatactttaaatgtcttagataaaaatccttaccaattagtatatgacattaaa
ggtattggttttaatagggctgaccaacttgctcgaaatgtcggtattgagccacattca
cctgaaagattaaaagcagcattattatttacgttagaagaagaatgtatcaaacaagga
catacatatctacctcgtacaattgttatagaaacaacacaaaatttactcaatgaagat
attgagaaaccaattgaaacagagcaattactagaaatcattgacgttttatcagaagag
aaaaaattaatatctgaagctgatcaggtatcaattccaagtttatactattcagaattg
aaaagtgtgcaaaacttataccgaattaaaacaaacacatctaaattaaaagaaatagaa
cagtctgatttacaaatacatattggtgatattgagtcacaaaatgaggttaattactct
gcctctcaaaaagaagcgcttgaaacagcaataaattctaaaattatgcttttaactggt
ggtccgggtaccggtaaaaccacagtcattaaaggtatagttgaattatatgcagaaata
catgggctctcgctcgattatgatgattacaatgaagatgattatccagtagtgttagct
gcacccactggtcgtgcttctaagcgccttcacgaatcgacaggtttagaagcaatgaca
attcatcgtttaatcggttggaaccaagatacacaaccacaggatattttagaaaatgag
atcaatgcaagactcattatcatcgatgaaatgtcaatggtagatacttggttgttccat
caatttttaagcgctgtgcctttagaagcacaaattgtatttgtcggagatgaagatcag
ttaccatcagtaggtccaggacaggtatttaaagaccttattgattctgaaataataccg
cgtgttaatcttaccgaagtatatcgtcagcaagatggttccagtattattgacttagct
caccgtatgaaattaaatgaacctatcgatattactaaacgttatcatgatcgtagtttt
attcgttgtggtacgaatcaaattccagacgttgttgataaagtagttaaaagcgctgta
gctaaaggctatgatatgagtgatatacaagttttggctcctatgtataaaggtaacgct
ggtattaagagacttaaccaagttctacaatctattcttaatccgaagcaacaagatgat
cgtgaaatagaatttggtgaagctgtgtttagaaaaggggataaagtacttcagttagtt
aatcgacctaatgataatatatttaatggggatataggtataatagtaggtatattttgg
gccaaagaaaatgctctaaataaggatgtgttagttgtagattttgaaggtaatgaaatt
acatttactaaacaagatttaatggaactaacacatgcatattgtacatctatccataaa
tcacaaggttcagaatttcctattgtaattatgcctattgttagacaatattataggatg
ttacaacgtcccattctttatacaggattaactagagctaaacaatcacttgttttgctt
ggtgaacaagaagcatttgatataggtttaaaaacaaatggacaaatacgattaacgcaa
ttaaatgatttgttaaaatcgtattttggacaaaacaaagataatttaactacaaataaa
caaacgattaacgaacaaaaagaaaataacaatcatctggatttgaaaaatgaaaaagaa
aatgatatccaattaaacgagtcgacaattttccaaatcgatccaatgattaatatgggg
gaaatgacgccatatgacttcgttgaacgttga

DBGET integrated database retrieval system