KEGG   Staphylococcus epidermidis ATCC 12228: SE1325Help
Entry
SE1325            CDS       T00110                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SE1325 (ruvA)
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SE1325 (ruvA)
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SE1325 (ruvA)
    RecFOR pathway proteins
     SE1325 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1357300..1357902)
Genome map
AA seq 200 aa AA seqDB search
MYAYIKGTLSQLFPTHVVVETCGIGYEIQTPNSYRFQKYLEKEVQIYTSLIVREDAQLLY
GFINEEEKEMFLSLIKVTGIGPKSALAILASSTPHEVKLAIENENDAYLTQFPGIGKKTA
RQIVLDLKGKVTITEENSDDLLQTQVNGNEQNQIISEALLALQALGYSKRELTKVEKSLN
KHNVNSVDEAVKIGLQTLVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcatatattaaaggaacattatctcagttgttccctacacatgtagtggttgag
acatgtggcataggttatgagatacaaacgcctaattcctatcgttttcaaaaatatctt
gaaaaagaagtccaaatttatacttcactaattgtacgagaagatgctcaactactatat
ggctttattaatgaagaggaaaaagaaatgtttcttagcttaataaaagtgactgggata
ggacctaaatcagctttagcgatacttgcttcaagtacaccacatgaagttaaattggct
atcgaaaatgaaaatgatgcttatttaacacaatttcctgggataggaaagaaaactgca
agacaaattgtgttagatttaaaagggaaggttacaattactgaagaaaatagtgacgat
ttattacaaactcaagttaatggtaatgaacaaaaccaaataatatctgaagcactatta
gctttacaagcactgggctattctaaacgagaattaaccaaagtagaaaaatccttaaac
aaacataatgtgaatagtgtggatgaagccgttaaaataggactacaaacactagtttct
taa

DBGET integrated database retrieval system