KEGG   Staphylococcus epidermidis ATCC 12228: SE1424Help
Entry
SE1424            CDS       T00110                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sep00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1463234..1464643)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVLEYENQMIEDLKGLLSIESIRDDSKATADAPVGPGPREALDYMYNLGKRDGFST
HDVDHIAGRIEAGKGEDVLGILCHVDVVPAGDGWDSNPFQPVVTDNAIIARGTLDDKGPT
IAAYYAVKILNEMKVDWKKRIHIIIGTDEESDWKCTDRYFKTEEMPALGFAPDAEFPAIH
GEKGITTFDLVQNEVTEDTDEPDYELLKFESGQRYNMVPDYAKAEVLVKENMTDVIQNFE
NFLQQNQLQGESTVDSGILILTIEGKAVHGMDPSLGVNAGLFLLKFLASLNLNKSAKDFV
EFNERYLFESHFGEKMGMKFHTDIMGDVTTNIGVISYDKEKAGRYGINLRYPEGFKFEDA
IDRFRSEINELGFNLELGKVQKPHYVDKNDPFVKTLVNAYRNQTGDMTEPYTIGGGTYAR
NLDKGVAFGAMFADSEDLMHQKNEYITKKQLINATSIYLEAIYALCVED
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaggttctagagtacgaaaatcaaatgattgaagatcttaaaggttta
ttatctatagaaagcatcagagatgattctaaagccactgctgatgcacctgtgggacca
ggaccgagagaagctcttgattacatgtacaatttaggtaaaagagatggtttttcaacg
catgacgttgatcatatagctggtagaattgaagctggtaaaggagaagatgtattaggt
attttatgtcatgtcgatgtagtacccgcaggcgatgggtgggattcaaacccattccaa
ccagtagtgacagacaatgcaattatagccagagggacactggatgataaaggacccacc
attgctgcctattatgcagttaaaattttaaatgagatgaaggtagattggaaaaaacgt
atacacattattatcggaactgatgaagaatcagattggaaatgtacagacagatatttc
aaaacagaagaaatgcctgccttaggttttgctccagatgcagaattcccagcaatacat
ggtgaaaaaggtataacaacctttgatttagtacaaaatgaagtgacagaagatacagat
gaacctgactatgagttattaaaatttgaatctggtcaaagatacaatatggttcctgat
tatgctaaggcagaagtgctcgtcaaagaaaatatgacagatgtcattcaaaactttgaa
aactttttacaacaaaatcaactacaaggtgaaagtacagttgacagtggtattttaata
ttaacaattgagggtaaagcagttcatggcatggatccatctttaggtgttaatgcagga
ttgtttttacttaaatttttagcaagtcttaatctaaataaaagcgcaaaagatttcgta
gaattcaatgagcgatacttatttgaatctcactttggtgaaaaaatgggtatgaagttc
catactgatattatgggagatgtcactactaatatcggggttatcagttatgataaagaa
aaagcaggccgttatggtattaatctaagatatcccgaaggatttaaatttgaagacgca
atcgatagatttagaagtgaaattaatgaactaggttttaatttagaacttggcaaagtt
caaaaaccacactatgtcgataaaaatgatccatttgtaaaaacacttgtaaacgcatat
agaaatcaaacaggtgatatgactgaaccatatacgattggtggaggaacatatgcgaga
aatttagataagggtgtcgcatttggtgcgatgtttgcagattcagaagatttaatgcat
caaaaaaatgagtatataactaaaaagcaattgatcaatgcaacaagtatttatttagaa
gctatttacgctttatgtgtggaggattaa

DBGET integrated database retrieval system