KEGG   Staphylococcus epidermidis ATCC 12228: SE1424Help
Entry
SE1424            CDS       T00110                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1424
  Amino acid metabolism
   00300 Lysine biosynthesis
    SE1424
Enzymes [BR:sep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SE1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1463234..1464643)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVLEYENQMIEDLKGLLSIESIRDDSKATADAPVGPGPREALDYMYNLGKRDGFST
HDVDHIAGRIEAGKGEDVLGILCHVDVVPAGDGWDSNPFQPVVTDNAIIARGTLDDKGPT
IAAYYAVKILNEMKVDWKKRIHIIIGTDEESDWKCTDRYFKTEEMPALGFAPDAEFPAIH
GEKGITTFDLVQNEVTEDTDEPDYELLKFESGQRYNMVPDYAKAEVLVKENMTDVIQNFE
NFLQQNQLQGESTVDSGILILTIEGKAVHGMDPSLGVNAGLFLLKFLASLNLNKSAKDFV
EFNERYLFESHFGEKMGMKFHTDIMGDVTTNIGVISYDKEKAGRYGINLRYPEGFKFEDA
IDRFRSEINELGFNLELGKVQKPHYVDKNDPFVKTLVNAYRNQTGDMTEPYTIGGGTYAR
NLDKGVAFGAMFADSEDLMHQKNEYITKKQLINATSIYLEAIYALCVED
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaggttctagagtacgaaaatcaaatgattgaagatcttaaaggttta
ttatctatagaaagcatcagagatgattctaaagccactgctgatgcacctgtgggacca
ggaccgagagaagctcttgattacatgtacaatttaggtaaaagagatggtttttcaacg
catgacgttgatcatatagctggtagaattgaagctggtaaaggagaagatgtattaggt
attttatgtcatgtcgatgtagtacccgcaggcgatgggtgggattcaaacccattccaa
ccagtagtgacagacaatgcaattatagccagagggacactggatgataaaggacccacc
attgctgcctattatgcagttaaaattttaaatgagatgaaggtagattggaaaaaacgt
atacacattattatcggaactgatgaagaatcagattggaaatgtacagacagatatttc
aaaacagaagaaatgcctgccttaggttttgctccagatgcagaattcccagcaatacat
ggtgaaaaaggtataacaacctttgatttagtacaaaatgaagtgacagaagatacagat
gaacctgactatgagttattaaaatttgaatctggtcaaagatacaatatggttcctgat
tatgctaaggcagaagtgctcgtcaaagaaaatatgacagatgtcattcaaaactttgaa
aactttttacaacaaaatcaactacaaggtgaaagtacagttgacagtggtattttaata
ttaacaattgagggtaaagcagttcatggcatggatccatctttaggtgttaatgcagga
ttgtttttacttaaatttttagcaagtcttaatctaaataaaagcgcaaaagatttcgta
gaattcaatgagcgatacttatttgaatctcactttggtgaaaaaatgggtatgaagttc
catactgatattatgggagatgtcactactaatatcggggttatcagttatgataaagaa
aaagcaggccgttatggtattaatctaagatatcccgaaggatttaaatttgaagacgca
atcgatagatttagaagtgaaattaatgaactaggttttaatttagaacttggcaaagtt
caaaaaccacactatgtcgataaaaatgatccatttgtaaaaacacttgtaaacgcatat
agaaatcaaacaggtgatatgactgaaccatatacgattggtggaggaacatatgcgaga
aatttagataagggtgtcgcatttggtgcgatgtttgcagattcagaagatttaatgcat
caaaaaaatgagtatataactaaaaagcaattgatcaatgcaacaagtatttatttagaa
gctatttacgctttatgtgtggaggattaa

DBGET integrated database retrieval system