KEGG   Staphylococcus epidermidis ATCC 12228: SE1511Help
Entry
SE1511            CDS       T00110                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sep00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1559797..1561245)
Genome map
AA seq 482 aa AA seqDB search
MAYFNKFLSNSERKRGKVSKKVAIIGAGITGLSSAYFIKKQDPSIEVTIFEASNRVGGKI
QTYRSDGYTIELGPESYLGRKTIMTDVAKDIGLENDLITNTTGQSYIFAKNKLYPIPGGS
IMGIPTDIKPFIKTRLISPIGKLRAGLDLFKKPIEIEDDISVGSFFRQRLGNEVLENLIE
PLMGGIYGTDIDQLSLMSTFPNFKEKEEQFGSLIKGMKDEKEQRIKKRQLYPGAPKGQFK
QFRHGLSSFIEALVKDIESKGVHIRYNTPVKDILISQKDYEILLEDDSKEKFNGLLVTTP
HQVFMNWFSHDPAFDYFKNMDSTTVATVVLAFDEKNITNTYDGTGFVIARTSQTDITACT
WTSKKWPFTTPEGKVLIRAYIGKPGDTVVDDHTDEEIVSIVRKDLSQMMTISGNPDFTIV
NRLPKSMPQYHVGHIKMIKEIQQHIKTTYPRLRVTGAPFEAVGLPDCIQQGKNAVDEILE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattttaataaatttttaagcaattctgaaaggaagcgtggaaaagtgagtaag
aaagtggcaattattggagcgggaatcactggtttatctagcgcatatttcattaaaaaa
caagacccttctattgaagtaactatcttcgaagcctcaaatagagtaggtggaaagatt
caaacatatagatcagatggttacacaattgagttaggccctgagtcttatttaggtcgt
aagacaattatgactgatgtggcaaaagatattggattagaaaatgaccttataacaaat
actactggccaatcttatatttttgctaaaaataaattatatcctattcctggtggctca
attatgggaattcctacagatattaaaccatttattaaaacaagactcatttcacctatt
ggtaaattaagagcggggcttgatttgtttaaaaaaccgatagaaattgaagatgatatt
tctgttggtagtttctttagacaacgattaggtaatgaagtattagagaacttaattgaa
ccactaatgggtggtatttatggcactgatattgatcaattgagcttaatgagtacattt
cctaactttaaagaaaaagaggaacaatttggtagtttgattaaaggaatgaaagatgaa
aaagaacaacgtattaaaaaacgtcaattatatccaggtgctcctaaaggacaattcaaa
cagtttagacacggattgagttcttttatagaggctcttgttaaagatattgaaagtaaa
ggtgtccacatacgatataacacgccagtcaaagatatattgatttcgcaaaaagattat
gaaattttattagaagatgacagcaaagagaaatttaatggcttacttgtaacaacgcca
catcaagtatttatgaattggtttagtcacgatcctgcatttgattactttaagaacatg
gattctactactgtcgcaacagttgttttggcctttgatgagaaaaatattaccaatacg
tacgatggaactggctttgttattgcaagaacaagtcaaacggatattactgcatgtact
tggacatcaaagaaatggccatttactactccagaaggtaaagttttaattcgagcatat
ataggaaaaccaggtgatactgtagtagatgatcacaccgatgaagaaatagtatcaatt
gttagaaaagacttaagccaaatgatgaccatctcagggaatcctgattttacaattgta
aatcggttacctaagagtatgccccaataccacgtgggtcatattaaaatgattaaagaa
attcaacaacatattaaaacaacttatcctagattacgtgttacaggggcaccgtttgaa
gctgttggtttaccagactgcatacaacaaggtaagaatgcagttgatgaaatattagaa
gagttataa

DBGET integrated database retrieval system