KEGG   Staphylococcus epidermidis ATCC 12228: SE1734Help
Entry
SE1734            CDS       T00110                                 

Definition
phosphopentomutase (EC:5.4.2.7)
Orthology
K01839  
phosphopentomutase [EC:5.4.2.7]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pentose phosphate pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SE1734
  Nucleotide metabolism
   00230 Purine metabolism
    SE1734
Enzymes [BR:sep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     SE1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1787057..1788247)
Genome map
AA seq 396 aa AA seqDB search
MTTPFKRIHLIVMDSVGIGEGPDAAAFNDEGSHTLKHTLEGFKQKLPHLEQLGLGNIAPL
PVVSKVTHPGAFYTKLSEASVGKDTMTGHWEIMGLNIMQPFKVYPNGFPAELVKEIESMT
GRKVVANRPASGTQIIDEWGEHQMKTGDLIVYTSADPVLQIAAHEDVIPLEELYEICEKV
RELTKDPKYLIGRIIARPYVGEPGNFTRTSNRHDYALKPFGRTVMNSLKDSGYDVIAIGK
INDIYDGEGVTEAIRTKNNMDGMDQLIEVVKKDFEGISFLNLVDFDALYGHRRDKEGYAQ
AIKDFDLRLPELMNHLREDDLVIITADHGNDPIAKGTDHTREYIPLLMFSPKIKDYHELS
QDTTFSSIGVTIADNFNVELPKYGKSYLKEMGVEHQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactacaccgttcaaaagaattcatctaatagttatggactcagtaggtataggcgaa
ggtcctgatgcagcggcattcaatgacgaaggatcacacactttaaagcatactttagaa
ggatttaagcaaaagttaccacatctagaacaacttggattaggaaatattgcaccgctt
cctgttgtttcaaaagtaacgcatccgggtgcattttataccaaactaagtgaagcttca
gtaggcaaggatacaatgacaggacattgggaaattatggggttaaatattatgcaacca
tttaaggtttatccaaatggtttcccagcagagcttgttaaagagattgaatcaatgact
ggacgcaaggttgtagcaaatagacctgcttcaggaactcagattattgacgagtggggc
gaacatcaaatgaaaactggagatttaatagtttatactagtgctgatccagtcttacaa
attgctgcacatgaagacgtgattccacttgaagaactttacgagatttgtgaaaaagtt
cgtgaactaacaaaagatcctaaatatttaatagggagaatcattgctcgaccatatgtt
ggtgaacctggtaacttcactagaacttctaatcgacatgattacgcgttaaaaccattt
ggacgaacagtgatgaatagccttaaagatagtggttatgatgtaatcgcgattggtaaa
attaacgatatttatgacggtgaaggcgtgacagaagctatacgtactaaaaataatatg
gacggtatggatcaattgattgaagttgtaaaaaaagattttgaaggtatcagtttcctt
aatttagttgattttgatgcattgtatggccatcgtcgtgataaagaagggtatgctcaa
gcaattaaagattttgatcttcgtttacctgaattaatgaatcatttaagagaagatgat
ttagttattattacagctgatcatggtaatgatccaattgctaaaggtacagatcataca
cgtgaatacattccacttttaatgtttagtccgaaaattaaagattatcatgaactttca
caagacacgacatttagctctatcggtgttacaatagcagataacttcaacgtagaatta
cctaaatatggaaaaagttatttaaaagaaatgggggttgagcatcaatga

DBGET integrated database retrieval system