KEGG   Staphylococcus epidermidis ATCC 12228: SE1913Help
Entry
SE1913            CDS       T00110                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00052  Galactose metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE1913
   00052 Galactose metabolism
    SE1913
Enzymes [BR:sep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SE1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1057935
NCBI-ProteinID: NP_765468
UniProt: A0A0H2VJX5
Position
complement(1949597..1950607)
Genome map
AA seq 336 aa AA seqDB search
MISKVEHQRHGLDLIKIDNDDTKIVFTNYGARIVSWKYHDNNIVLGNVVEADEFYFEEPF
NFGATIGRYAGRIENASFKLDDDTFQLESNDGQHHLHGGSHGLNRRIFDYEIVDDIGQVK
IIFTTTIKEEEDNYPGDMMVKVIHTYDANHRWSVQYEAKSTKKTVFNPSNHVYFNLNRDN
NVVYNHCINSSALKMYMLNNKHIVKEGQSLDLHRLLDTNKVYLKDIFESDNETLQQQINH
YNGIDHPFEFGGNELTIDNSEFELNIKTDMPHFVMFTFNDPQVWNNDFNIYKAHSGFSIE
TQYMPNDINMYGAKAQSILEADTLFTSKTSFQIHEK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatatctaaagttgaacatcaaagacacggtttagatttaattaaaattgataatgac
gatacgaaaattgtatttacaaactatggtgcaagaattgtttcttggaaataccatgat
aacaatatcgttttagggaatgtagtagaagcggatgaattttattttgaagaacctttt
aattttggtgctacgataggtcgctatgcgggtagaattgaaaatgcatcatttaaatta
gatgatgatacttttcaattagaatcaaatgatggtcaacatcatttgcatgggggcagt
catggattaaatagacgtatttttgattatgaaatagttgatgatattggacaagtaaag
attatattcacaacaacgattaaagaagaagaggacaattatcctggagatatgatggta
aaggttattcacacttatgatgccaatcatcgatggtccgtacaatatgaggcaaaatca
acaaaaaaaacagtatttaatccttcaaatcatgtttattttaatttgaatcgtgataac
aatgttgtctataaccactgtataaatagttcagcattaaaaatgtatatgttaaataat
aaacatattgttaaagaggggcaatctcttgatttacatcgattattggatacaaataaa
gtctatttaaaagatatttttgaaagtgacaatgaaactttgcaacaacaaattaatcat
tataatggcattgatcatcctttcgaatttggtggaaatgagcttaccattgataattct
gaatttgaacttaatattaagactgatatgcctcattttgtaatgtttacgtttaatgat
ccacaagtttggaacaatgattttaatatttataaggcgcattctggattttccatcgaa
actcaatatatgcctaatgatataaatatgtacggcgccaaagctcagtctattttagag
gcagatacattatttacatctaaaacaagttttcaaattcatgaaaagtag

DBGET integrated database retrieval system