KEGG   Staphylococcus epidermidis ATCC 12228: SE2043Help
Entry
SE2043            CDS       T00110                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00040  Pentose and glucuronate interconversions
sep00052  Galactose metabolism
sep00500  Starch and sucrose metabolism
sep00520  Amino sugar and nucleotide sugar metabolism
sep01100  Metabolic pathways
sep01130  Biosynthesis of antibiotics
Module
sep_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SE2043
   00052 Galactose metabolism
    SE2043
   00500 Starch and sucrose metabolism
    SE2043
   00520 Amino sugar and nucleotide sugar metabolism
    SE2043
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SE2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 1055993
NCBI-ProteinID: NP_765598
UniProt: Q8CR67
Position
complement(2086063..2086764)
Genome map
AA seq 233 aa AA seqDB search
MTGKHKRAIEDHFDNQKELEMVLENKGKADLLEKVQYSTDLANIFYVRQKEQKGLGHAIH
TAKQFIGNEPFAVLLGDDIVESDTPAIKQLMDVYEETGHSVIGVQEVPESDTHRYGVIDP
SAKEGSRYEVRQFVEKPKQGTAPSNLAIMGRYVLTPEIFDYLETQQEGAGNEIQLTDAIE
RMNSKQQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDLKAFIKQLDI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgactggcaagcataaacgtgcaattgaagatcactttgataatcaaaaagaattagaa
atggttcttgaaaataaaggaaaagcagacctgcttgaaaaagtacaatattcaacagat
ttagctaatattttttacgtacgacaaaaagaacaaaaagggctaggacatgcaattcat
actgcaaaacagtttatcggtaacgaaccatttgcagtgttattaggagatgacattgta
gagtctgatactccagctattaaacaattaatggatgtttatgaagaaacaggccattca
gtaataggggttcaagaagtgccagaatctgatacacatcgttatggtgtgattgatcct
tctgctaaagaggggagtcgatatgaagtacgtcaatttgtagaaaagccgaaacaaggt
actgccccgtctaatttagcaatcatgggtcgttatgtattaacaccagaaatttttgat
tatcttgaaacacaacaagaaggtgctggaaatgaaattcaattaactgatgcgattgaa
cgaatgaatagcaaacaacaagtgtatgcatatgattttgagggtaatcgttatgatgtt
ggagaaaaattaggatttgttaaaacaacgattgaatatgctttaaaagatccagaaatg
agtcaagacttaaaagcattcattaagcaactagatatttaa

DBGET integrated database retrieval system