KEGG   Staphylococcus epidermidis ATCC 12228: SE2043Help
Entry
SE2043            CDS       T00110                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SE2043
   00052 Galactose metabolism
    SE2043
   00500 Starch and sucrose metabolism
    SE2043
   00520 Amino sugar and nucleotide sugar metabolism
    SE2043
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SE2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2086063..2086764)
Genome map
AA seq 233 aa AA seqDB search
MTGKHKRAIEDHFDNQKELEMVLENKGKADLLEKVQYSTDLANIFYVRQKEQKGLGHAIH
TAKQFIGNEPFAVLLGDDIVESDTPAIKQLMDVYEETGHSVIGVQEVPESDTHRYGVIDP
SAKEGSRYEVRQFVEKPKQGTAPSNLAIMGRYVLTPEIFDYLETQQEGAGNEIQLTDAIE
RMNSKQQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDLKAFIKQLDI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgactggcaagcataaacgtgcaattgaagatcactttgataatcaaaaagaattagaa
atggttcttgaaaataaaggaaaagcagacctgcttgaaaaagtacaatattcaacagat
ttagctaatattttttacgtacgacaaaaagaacaaaaagggctaggacatgcaattcat
actgcaaaacagtttatcggtaacgaaccatttgcagtgttattaggagatgacattgta
gagtctgatactccagctattaaacaattaatggatgtttatgaagaaacaggccattca
gtaataggggttcaagaagtgccagaatctgatacacatcgttatggtgtgattgatcct
tctgctaaagaggggagtcgatatgaagtacgtcaatttgtagaaaagccgaaacaaggt
actgccccgtctaatttagcaatcatgggtcgttatgtattaacaccagaaatttttgat
tatcttgaaacacaacaagaaggtgctggaaatgaaattcaattaactgatgcgattgaa
cgaatgaatagcaaacaacaagtgtatgcatatgattttgagggtaatcgttatgatgtt
ggagaaaaattaggatttgttaaaacaacgattgaatatgctttaaaagatccagaaatg
agtcaagacttaaaagcattcattaagcaactagatatttaa

DBGET integrated database retrieval system