KEGG   Staphylococcus epidermidis ATCC 12228: SE2063Help
Entry
SE2063            CDS       T00110                                 

Definition
(RefSeq) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00030  Pentose phosphate pathway
sep00051  Fructose and mannose metabolism
sep00680  Methane metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2063
   00030 Pentose phosphate pathway
    SE2063
   00051 Fructose and mannose metabolism
    SE2063
  Energy metabolism
   00680 Methane metabolism
    SE2063
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SE2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 1056023
NCBI-ProteinID: NP_765618
UniProt: Q8CN27
Position
2106217..2108181
Genome map
AA seq 654 aa AA seqDB search
MTHITESEMKQKYLDLLSQKFDSAEKLATEIINLESILELPKGTEHFVSDLHGEYESFQH
VLRNGSGNVRAKINDIFKDKLSQQEINDLAALVYYPEEKLKLVKNNFDSIGTLNIWYITT
IQRLIDLITYCSSKYTRSKLRKALPEQYVYIIEELLYKSNEFHNKKPYYETLVNQIIELE
QSDDLIIGLSYTVQRLVVDHLHVVGDIYDRGPKPDKIMDTLINYHSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDAENPAFKPKKRPDKD
VSLTKREESQITKIHQAIAMIQFKLEMPIIKRRPSFEMEERLVLEKIDYDNNEITIYNKT
YPLKDTCFQTVNPNNPAELLAEEKEVMDKLLLSFQQSEKLRRHMSFLMRKGKLYLPYNGN
LLIHGCIPVDENGEMESFEIEGERLSGRELLDVFEYHVRRAFDHKESTEDISTDLVWYLW
TGKYSSLFGKRAMTTFERYFIEDKASHKEEKNPYYYLREDVDMIRKMLKDFGLNPDEGRI
INGHTPVKEIDGEDPIKANGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHKEFN
RKEKVLSMGADELSVKRVVDEELQRKKIRDTNIGKQLQDQIDILKILMHDRYLT
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacccatattacagaaagtgaaatgaaacaaaaatatctagatttactctcacaaaaa
tttgacagtgcagaaaaacttgctactgaaattattaacttagagtcaatcttagaatta
cctaaagggactgaacattttgttagtgaccttcatggtgaatacgaatctttccaacat
gttttaagaaacggatctggaaatgtgcgtgctaaaattaatgatatcttcaaagataaa
ttatcccagcaagaaatcaacgacttagcagcattagtatactatccggaagaaaaacta
aaattagttaaaaataatttcgattcaatcggaacattaaatatttggtatattacaacc
attcaacgattaattgatttaattacatattgctcatcaaaatatacacgttcaaaatta
cgcaaagcattacctgaacaatacgtttatattattgaagagctactttacaagagcaat
gaatttcataataaaaagccttattatgaaacattagttaaccaaattattgaattagaa
caatcagatgatttgattattggcctttcctatactgtacaacgtctagtcgtagaccat
cttcatgtcgtgggcgatatctatgaccgtggtcctaaacctgataaaattatggataca
ttaataaattatcattctgtagatatccaatggggaaatcatgatgtattatggattggc
gcctatgctggttcaaaagtatgtcttgctaacctactacgaatctgtgcacgttatgat
aatttagatattatcgaagatgcatatggcatcaatctacgtcctttacttacgcttgct
gaaaagtattacgatgctgaaaacccagcgtttaaacctaagaaacgaccagataaagac
gtcagtcttacaaaacgcgaagaaagtcaaatcacaaaaattcatcaagcaattgcgatg
attcaatttaaacttgaaatgcctattattaagcgccgtccttcttttgagatggaagaa
cgtttagttttagaaaaaatagattatgataataatgaaatcactatatataataaaaca
tatccgcttaaagatacttgtttccaaactgtaaaccctaacaatcccgctgagttacta
gcagaggaaaaagaagttatggataagctattactttcattccaacaatctgaaaaatta
agacgtcatatgtctttccttatgcgaaaaggaaaattatatcttccatataatggcaac
cttttaattcacggttgtattcccgtcgatgaaaatggagaaatggaatcatttgaaatt
gaaggtgaacgtttaagtggtcgtgaactactcgatgtttttgaatatcatgtaagaaga
gcttttgaccataaagaatctaccgaagacatttctacagatttagtatggtatctttgg
acaggtaaatattcatctttatttggtaaacgtgccatgacaacgtttgaacgttatttt
atagaagataaagcatctcataaagaggagaaaaatccttattattacttacgtgaagat
gttgatatgatacgtaaaatgttaaaggattttggtcttaatccagatgaaggacgtatc
ataaatggtcatacgcctgttaaagaaattgatggtgaagatccaattaaagctaatggt
aaaatgttagtcatagatggaggattttcaaaagcttatcaatcaacaactggtattgcc
ggatacacacttttatataattcatttggtatgcaattggttgcacataaagagttcaat
agaaaagaaaaagtgttatcaatgggggcagatgaattgtcagtgaaacgcgttgtagat
gaagaattgcaacgtaaaaaaattagagataccaatatcggtaaacaacttcaagatcaa
attgatatcctcaaaattttaatgcacgaccgatatttaacataa

DBGET integrated database retrieval system