KEGG   Staphylococcus epidermidis ATCC 12228: SE2063Help
Entry
SE2063            CDS       T00110                                 

Definition
fructose-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE2063
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2063
   00030 Pentose phosphate pathway
    SE2063
   00051 Fructose and mannose metabolism
    SE2063
  Energy metabolism
   00680 Methane metabolism
    SE2063
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SE2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2106217..2108181
Genome map
AA seq 654 aa AA seqDB search
MTHITESEMKQKYLDLLSQKFDSAEKLATEIINLESILELPKGTEHFVSDLHGEYESFQH
VLRNGSGNVRAKINDIFKDKLSQQEINDLAALVYYPEEKLKLVKNNFDSIGTLNIWYITT
IQRLIDLITYCSSKYTRSKLRKALPEQYVYIIEELLYKSNEFHNKKPYYETLVNQIIELE
QSDDLIIGLSYTVQRLVVDHLHVVGDIYDRGPKPDKIMDTLINYHSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDAENPAFKPKKRPDKD
VSLTKREESQITKIHQAIAMIQFKLEMPIIKRRPSFEMEERLVLEKIDYDNNEITIYNKT
YPLKDTCFQTVNPNNPAELLAEEKEVMDKLLLSFQQSEKLRRHMSFLMRKGKLYLPYNGN
LLIHGCIPVDENGEMESFEIEGERLSGRELLDVFEYHVRRAFDHKESTEDISTDLVWYLW
TGKYSSLFGKRAMTTFERYFIEDKASHKEEKNPYYYLREDVDMIRKMLKDFGLNPDEGRI
INGHTPVKEIDGEDPIKANGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHKEFN
RKEKVLSMGADELSVKRVVDEELQRKKIRDTNIGKQLQDQIDILKILMHDRYLT
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacccatattacagaaagtgaaatgaaacaaaaatatctagatttactctcacaaaaa
tttgacagtgcagaaaaacttgctactgaaattattaacttagagtcaatcttagaatta
cctaaagggactgaacattttgttagtgaccttcatggtgaatacgaatctttccaacat
gttttaagaaacggatctggaaatgtgcgtgctaaaattaatgatatcttcaaagataaa
ttatcccagcaagaaatcaacgacttagcagcattagtatactatccggaagaaaaacta
aaattagttaaaaataatttcgattcaatcggaacattaaatatttggtatattacaacc
attcaacgattaattgatttaattacatattgctcatcaaaatatacacgttcaaaatta
cgcaaagcattacctgaacaatacgtttatattattgaagagctactttacaagagcaat
gaatttcataataaaaagccttattatgaaacattagttaaccaaattattgaattagaa
caatcagatgatttgattattggcctttcctatactgtacaacgtctagtcgtagaccat
cttcatgtcgtgggcgatatctatgaccgtggtcctaaacctgataaaattatggataca
ttaataaattatcattctgtagatatccaatggggaaatcatgatgtattatggattggc
gcctatgctggttcaaaagtatgtcttgctaacctactacgaatctgtgcacgttatgat
aatttagatattatcgaagatgcatatggcatcaatctacgtcctttacttacgcttgct
gaaaagtattacgatgctgaaaacccagcgtttaaacctaagaaacgaccagataaagac
gtcagtcttacaaaacgcgaagaaagtcaaatcacaaaaattcatcaagcaattgcgatg
attcaatttaaacttgaaatgcctattattaagcgccgtccttcttttgagatggaagaa
cgtttagttttagaaaaaatagattatgataataatgaaatcactatatataataaaaca
tatccgcttaaagatacttgtttccaaactgtaaaccctaacaatcccgctgagttacta
gcagaggaaaaagaagttatggataagctattactttcattccaacaatctgaaaaatta
agacgtcatatgtctttccttatgcgaaaaggaaaattatatcttccatataatggcaac
cttttaattcacggttgtattcccgtcgatgaaaatggagaaatggaatcatttgaaatt
gaaggtgaacgtttaagtggtcgtgaactactcgatgtttttgaatatcatgtaagaaga
gcttttgaccataaagaatctaccgaagacatttctacagatttagtatggtatctttgg
acaggtaaatattcatctttatttggtaaacgtgccatgacaacgtttgaacgttatttt
atagaagataaagcatctcataaagaggagaaaaatccttattattacttacgtgaagat
gttgatatgatacgtaaaatgttaaaggattttggtcttaatccagatgaaggacgtatc
ataaatggtcatacgcctgttaaagaaattgatggtgaagatccaattaaagctaatggt
aaaatgttagtcatagatggaggattttcaaaagcttatcaatcaacaactggtattgcc
ggatacacacttttatataattcatttggtatgcaattggttgcacataaagagttcaat
agaaaagaaaaagtgttatcaatgggggcagatgaattgtcagtgaaacgcgttgtagat
gaagaattgcaacgtaaaaaaattagagataccaatatcggtaaacaacttcaagatcaa
attgatatcctcaaaattttaatgcacgaccgatatttaacataa

DBGET integrated database retrieval system