KEGG   Staphylococcus epidermidis ATCC 12228: SE2086Help
Entry
SE2086            CDS       T00110                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SE2086
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SE2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131751..2132674)
Genome map
AA seq 307 aa AA seqDB search
MNKNKVIVIGSTNVDKFLNVKRFPKPGETLHINQAQKEFGGGKGANQAIAASRLAADTTF
ISKVGKDGNANFILEDFKKAGIHTQYILTSESEETGQAFITVDEAGQNTILVYGGANMTL
SATDVEMSADAFIGADFVVAQLEVPFEAIEQAFKIARKQNITTVLNPAPAIELPKSLLEL
TDIIIPNETEAELLTGISINNESDMKETATYFLDLGISAVLITLGEQGTYCAYQEQYKMI
PACNVKAIDTTAAGDTFIGAFLSELNKDLSNIESAIRLANQASSLTVQRKGAQASIPTRK
EVEAEYN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaataaagtgattgtaattggatcaacaaatgtagataaatttcttaatgtt
aaaaggtttccaaaacccggtgagacattacatattaatcaagctcaaaaggagtttggt
gggggcaagggagccaatcaagccatagcagctagtagattagcagcagatacaacattt
atcagtaaagttggtaaagatggcaatgccaactttatattggaagatttcaaaaaagca
ggtattcatacacaatatattttaacttcagaaagtgaagaaactgggcaagcatttatc
actgttgatgaagcaggacaaaatacgattcttgtttacggtggtgcgaatatgacatta
agtgcaactgatgttgagatgagtgcggatgcgtttattggtgcagactttgttgtagcg
cagcttgaagttccatttgaggcgatagaacaagcatttaaaattgctcgtaaacaaaat
atcactactgtattaaatcctgcaccggcaattgaattgcctaagtcacttttagagtta
actgatataattattccaaacgaaacggaagcagaattattaacaggtatttcaatcaat
aatgaaagtgatatgaaagaaacagcaacatattttctcgatttaggtatatctgcagta
ttaattactttaggggagcaaggcacgtattgtgcatatcaagaacaatacaaaatgatt
cctgcgtgtaatgtaaaagcaatagatacgacagcagcaggagatacatttataggtgct
tttttaagtgagttaaataaagatttgagtaatatagaatcggctattcgacttgcaaat
caagcgtcgtctctaacggtacaacgaaaaggagcacaagcttctataccaacacgtaaa
gaagtagaggcagaatataattaa

DBGET integrated database retrieval system