KEGG   Staphylococcus epidermidis ATCC 12228: SE2098Help
Entry
SE2098            CDS       T00110                                 

Definition
sorbitol dehydrogenase-like protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sep01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sep00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sep00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sep00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sep00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2142237..2143289
Genome map
AA seq 350 aa AA seqDB search
MKAYEYLKPGHAQLTDKEKPTITSSTDAIIRIVKTTICGTDLHIIKGDTPEVKSHTTLGH
EGIGIIEEIGDNVNNFKVGDKVIISCISSCGKCYYCKKGIYAHCENGGGWILGHLVNGTQ
AEYVKVPFADNSLYHAPSNLKEDALVMLSDILPTGYEIGVLKGKVKPGCTVAIVGAGPVG
LAALLTAQFYSPSKIIMIDLDDNRLETAKEIGATHLINSKETETAIKKVKSLNPRGVDVA
IEAVGIPQTFDLCQNLIGVDGTIANVGVHGLPVQLDIDKLWIKNINVTTGLVSGNTTEEL
LEALKSKIIQPEQLVTHYSKLSEIESAYDLFRNATDHKAIKLIIENDITI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttatgaatacttaaaacctggtcatgcacaacttacggataaagagaagcca
accattacgagcagtactgacgctattattcgcatagttaagacgacaatatgtggtaca
gatcttcatatcataaaaggagatacacctgaagttaaatcacatacgacactaggtcac
gaaggtattggaatcattgaagaaattggtgacaacgttaacaacttcaaagttggagat
aaagtgattatctcttgcatttcatcatgtggcaaatgctactattgcaaaaaaggtatc
tatgcacattgtgaaaacggaggaggatggatattaggacatttagtgaatggtactcaa
gcagaatatgttaaagttccttttgcagataattctttatatcacgccccttcaaattta
aaagaagacgcccttgtaatgttatcagatatacttccaacaggttatgaaattggtgtt
ttaaaaggtaaagttaaacctggctgtacagtagccattgtaggtgctggtcctgtaggt
ttagcagcattacttacagcacaattctattcaccttcaaaaattattatgattgattta
gatgataatagattagaaaccgctaaagaaataggtgctacgcatttaattaactctaaa
gagactgaaaccgcaattaaaaaggtaaaatcgttaaatccacgtggtgttgatgttgct
attgaagctgtcggaattccacaaacctttgatttatgtcaaaatttaattggtgtcgat
ggtacgattgctaatgttggtgtgcatgggttacctgtacaacttgatatagataaatta
tggattaaaaatattaacgtaactactggtttagtttcaggaaatacaactgaagaatta
cttgaagcgttaaaaagcaaaataatacaaccagaacaactcgtgacacattatagtaaa
ctgagtgaaatcgaaagtgcctatgatttatttagaaatgcaacagatcataaagcgatt
aaattaatcatagagaatgatatcacaatttaa

DBGET integrated database retrieval system