KEGG   Staphylococcus epidermidis ATCC 12228: SE2161Help
Entry
SE2161            CDS       T00110                                 

Definition
(RefSeq) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00620  Pyruvate metabolism
sep00640  Propanoate metabolism
sep00680  Methane metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2161
   00620 Pyruvate metabolism
    SE2161
   00640 Propanoate metabolism
    SE2161
  Energy metabolism
   00680 Methane metabolism
    SE2161
Enzymes [BR:sep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SE2161
Lipid biosynthesis proteins [BR:sep01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SE2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1056277
NCBI-ProteinID: NP_765716
UniProt: A0A0H2VIL4
Position
complement(2209362..2210957)
Genome map
AA seq 531 aa AA seqDB search
MNKSNLLAPENYNIVTEIEKYASEDHKKAIIYKDNEHENISVSYKELISNANKVGNVFLN
HGLKKGDKVLIMMPRAIVTYELYIAALKLGIAIVPSSEMLRTKDLQYRITHGEIDAVISF
DSLTKEFENVKEYDQLKKFIVAGHKEDWVSIEDEKEKVSDDLKGADTTRDDLAILSYTSG
TTGNPKAVTHSHGWGYAHLQMAPKHWLCIQENDLVWATAAPGWQKWVWSPFLSVLGMGAT
AFVYNGRFHPETYLELLQNYQINVLCCTPTEYRMMAKLSHLEQYNLEYLHSAVSAGEPLN
REVVEQFKRHFNITVRDGYGQTESTLLIGFLKDTEPRMGSMGKGIPGSFVTVIDDDGKEV
GPNVKGNIAVPLDLPALFKGYFKDEARTKAASTGDYYVTGDQAHIDNDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHAAVKECAVVASPHDIRGNIVKAFIILQDDYEASDELIQEL
QVFCKNEVAPYKYPRAIEFVEHLPKTNSGKIRRVELRDAEIKKYKQQDSSH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaaatttactagcacctgagaattataatattgttacagaaatagaaaaa
tatgcctcagaagatcataaaaaagccattatttacaaggataacgagcatgaaaatatt
tctgtaagttataaagaacttatcagtaatgctaataaagtagggaatgtattcctcaat
catgggctaaaaaagggagataaagttctcatcatgatgccacgtgcaatcgttacatat
gaattatatattgcagcattgaaactagggatagcgattgttccaagttcggaaatgtta
cgaacaaaagatttacaatatcgaattactcacggtgagattgatgcagttatttcattt
gattctctaactaaagaatttgaaaacgttaaagaatatgaccaattaaaaaaatttata
gtagctggtcacaaagaagattgggtttcaatagaagatgaaaaagaaaaagtaagtgat
gaccttaaaggcgcagatacaacacgagatgatttggcgattctttcttatacatcaggt
acaacaggcaatccaaaagcagtaacgcattcacatggatgggggtatgcccatttacaa
atggcaccaaaacattggttatgtatacaagagaatgatcttgtatgggcaactgcagca
ccagggtggcaaaagtgggtgtggagtccatttttatctgtattagggatgggagcaaca
gcatttgtctataacggtcgtttccaccctgaaacatatctcgagttacttcaaaattat
caaattaatgttctatgttgtacaccaacagaatatcgtatgatggctaaacttagtcat
ttagaacagtacaatttagagtatttacacagtgcggtgtctgcgggtgaacctttaaat
cgagaagttgttgaacaatttaaacgtcattttaatattactgttcgagatggatatgga
caaaccgaaagtacattgttgatcggatttctaaaagatactgaaccacgtatgggttct
atgggcaaaggtatacctggtagttttgttactgtcattgacgatgatggtaaagaggtt
ggtccaaatgttaaaggtaatatcgccgtgcctttagacttaccggctttatttaaaggt
tactttaaagatgaagcacgcacaaaagcagcttcaacaggtgattattatgttactgga
gaccaagctcatattgataatgatggttatttctggttcgaaggtcgccgtgacgatatt
atcattagttcaggatataccattggacctttcgaggtagaagatgcactaacaaatcac
gcagctgttaaagaatgtgcagttgttgcaagtcctcatgacattcgtggaaatattgtt
aaagcatttatcatcttgcaagatgattatgaagcaagtgatgagttaatccaagaatta
caagtattttgtaaaaatgaagtagcaccgtataaatatccaagagcaattgaatttgtt
gaacatctaccaaaaacaaattcaggtaagatacgtcgtgttgaattacgtgacgcagaa
ataaaaaaatataaacaacaagattcatcacattaa

DBGET integrated database retrieval system