KEGG   Staphylococcus epidermidis ATCC 12228: SE2161Help
Entry
SE2161            CDS       T00110                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sep00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sep00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sep00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2209362..2210957)
Genome map
AA seq 531 aa AA seqDB search
MNKSNLLAPENYNIVTEIEKYASEDHKKAIIYKDNEHENISVSYKELISNANKVGNVFLN
HGLKKGDKVLIMMPRAIVTYELYIAALKLGIAIVPSSEMLRTKDLQYRITHGEIDAVISF
DSLTKEFENVKEYDQLKKFIVAGHKEDWVSIEDEKEKVSDDLKGADTTRDDLAILSYTSG
TTGNPKAVTHSHGWGYAHLQMAPKHWLCIQENDLVWATAAPGWQKWVWSPFLSVLGMGAT
AFVYNGRFHPETYLELLQNYQINVLCCTPTEYRMMAKLSHLEQYNLEYLHSAVSAGEPLN
REVVEQFKRHFNITVRDGYGQTESTLLIGFLKDTEPRMGSMGKGIPGSFVTVIDDDGKEV
GPNVKGNIAVPLDLPALFKGYFKDEARTKAASTGDYYVTGDQAHIDNDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHAAVKECAVVASPHDIRGNIVKAFIILQDDYEASDELIQEL
QVFCKNEVAPYKYPRAIEFVEHLPKTNSGKIRRVELRDAEIKKYKQQDSSH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaaatttactagcacctgagaattataatattgttacagaaatagaaaaa
tatgcctcagaagatcataaaaaagccattatttacaaggataacgagcatgaaaatatt
tctgtaagttataaagaacttatcagtaatgctaataaagtagggaatgtattcctcaat
catgggctaaaaaagggagataaagttctcatcatgatgccacgtgcaatcgttacatat
gaattatatattgcagcattgaaactagggatagcgattgttccaagttcggaaatgtta
cgaacaaaagatttacaatatcgaattactcacggtgagattgatgcagttatttcattt
gattctctaactaaagaatttgaaaacgttaaagaatatgaccaattaaaaaaatttata
gtagctggtcacaaagaagattgggtttcaatagaagatgaaaaagaaaaagtaagtgat
gaccttaaaggcgcagatacaacacgagatgatttggcgattctttcttatacatcaggt
acaacaggcaatccaaaagcagtaacgcattcacatggatgggggtatgcccatttacaa
atggcaccaaaacattggttatgtatacaagagaatgatcttgtatgggcaactgcagca
ccagggtggcaaaagtgggtgtggagtccatttttatctgtattagggatgggagcaaca
gcatttgtctataacggtcgtttccaccctgaaacatatctcgagttacttcaaaattat
caaattaatgttctatgttgtacaccaacagaatatcgtatgatggctaaacttagtcat
ttagaacagtacaatttagagtatttacacagtgcggtgtctgcgggtgaacctttaaat
cgagaagttgttgaacaatttaaacgtcattttaatattactgttcgagatggatatgga
caaaccgaaagtacattgttgatcggatttctaaaagatactgaaccacgtatgggttct
atgggcaaaggtatacctggtagttttgttactgtcattgacgatgatggtaaagaggtt
ggtccaaatgttaaaggtaatatcgccgtgcctttagacttaccggctttatttaaaggt
tactttaaagatgaagcacgcacaaaagcagcttcaacaggtgattattatgttactgga
gaccaagctcatattgataatgatggttatttctggttcgaaggtcgccgtgacgatatt
atcattagttcaggatataccattggacctttcgaggtagaagatgcactaacaaatcac
gcagctgttaaagaatgtgcagttgttgcaagtcctcatgacattcgtggaaatattgtt
aaagcatttatcatcttgcaagatgattatgaagcaagtgatgagttaatccaagaatta
caagtattttgtaaaaatgaagtagcaccgtataaatatccaagagcaattgaatttgtt
gaacatctaccaaaaacaaattcaggtaagatacgtcgtgttgaattacgtgacgcagaa
ataaaaaaatataaacaacaagattcatcacattaa

DBGET integrated database retrieval system