KEGG   Staphylococcus epidermidis ATCC 12228: SE2197Help
Entry
SE2197            CDS       T00110                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SE2197
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SE2197
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE2197
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SE2197
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SE2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247709..2249178
Genome map
AA seq 489 aa AA seqDB search
MKFMNKMGKTTLASSIVAASVLSTVNVSYASGSSEQSAQTKQTQNDAIAFGNTKNPKNVI
FMVGDGMGPSFNTAYRYYKNKPGAKKMTPTAFDKYLKGTNRTYSNDPKENVTDSAAGGTA
FSTGHKTYNGAISVDTNKKPIKSVLEQAKEQGKSTGLVTTAELTDATPAVYAAHVDSRDK
KDEIAQQFYNDKINGKHKVDVMLGGGAKYFGKENKNLAKKFKKDGYDIVSNKDELNQSQS
KQVLGTFSEKDMPLQIDAPQSNPLLVDMQNSALNKLSKNNKGFFLMVEGASIDKAAHPND
ITGVMSEMSGFETAFDNAINYAKTHKDTLVVATADHSTGGLSTAKGKDYKWNPEAIHKMK
HSGMYMTKQIADGKDPEKVIKDGYGIDFPNKQLDKVKKAADELHKLQKEGKDDKDEKVVE
QTTKLQNAIQKPINDASHTGWTTNGHTGVDVNTYAYGPGSNKFKGNMENTQSAKNLFDFF
GNNVTSNQN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatgaacaaaatgggtaagacgacgcttgcttcatcaatcgtagcagcatcc
gttttaagtacggtaaacgtatcatatgcttcaggtagctcagaacaaagtgctcaaact
aagcaaacacaaaacgatgccattgctttcggcaacacaaaaaatccaaaaaatgtcatc
ttcatggttggcgatggtatgggaccttcttttaacactgcatatcgttattataaaaat
aagcctggtgctaagaaaatgactccaactgcattcgataaatatctaaaaggaacaaat
cgtacttattctaatgatcctaaagaaaatgttacagactctgctgctggaggaacagct
tttagtaccggtcacaaaacatataacggtgcgattagtgttgatacaaataaaaaacca
attaaatctgtgctagaacaagctaaagaacaaggaaaatcaactggtttagtaactact
gctgaacttactgatgcaacacctgctgtatatgctgctcatgtagattcacgcgacaaa
aaagatgaaattgcacagcaattttataatgataaaataaatggtaaacataaagtcgat
gtgatgttaggtggcggtgcaaaatacttcggtaaagaaaataaaaatttagcgaaaaaa
ttcaaaaaagatggttatgatatcgtttctaataaagatgaattaaatcaatcacaaagc
aagcaagttttaggtactttctcagaaaaagatatgccattacaaatagatgcacctcaa
tctaatccgttgctagtagacatgcaaaacagtgcactaaataaattaagtaaaaataat
aaaggattctttttaatggttgagggtgcttcaattgataaagctgcccaccctaatgat
atcactggtgtgatgtctgaaatgtctggtttcgaaactgcttttgataatgctattaat
tatgcaaagacacataaagatacacttgttgtagcaactgcagaccactcaactggcggt
ctatcaaccgcaaaaggtaaagattataaatggaatccagaggctattcacaagatgaaa
cattctggaatgtatatgacaaaacaaatcgctgatggaaaagatcctgaaaaagtaatt
aaagatggatacggcattgatttcccaaataaacaactcgataaagtcaaaaaagcagca
gacgagcttcacaaattacaaaaagaaggtaaagatgacaaagacgaaaaagttgtagaa
caaacaacaaaattacaaaatgcaattcaaaaaccaattaacgatgcttcacacacaggt
tggacaaccaatggccatacaggtgtagatgttaacacatatgcatatgggccaggttct
aacaaattcaaagggaatatggaaaatacccaaagcgctaaaaacttatttgactttttc
ggaaacaatgtaacatcaaatcaaaattaa

DBGET integrated database retrieval system