KEGG   Staphylococcus epidermidis ATCC 12228: SE2269Help
Entry
SE2269            CDS       T00110                                 

Definition
dihydropteroate synthase chain A synthetase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sep00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2341570..2342388)
Genome map
AA seq 272 aa AA seqDB search
MIKTKIMGILNVTPDSFSDGGQYHSVDQAVKRAKEMIDEGVDIIDVGGVSTRPGHKEVSH
KEVSLKEEMNRVLPVVESIVKYDVQISVDTFRSEVAEACLKLGVSMINDQWAGLFDSNMF
NVVSQYGAEIVLTHNGDGHRDKPVVEEMLVSLLAQANKAELAGIPHNKIWLDPGIGFPKT
REEENEVMARLDELVATEYPVLLATSRKRYIKEMMNQDSSPSDRDEATAATTAYGIMKGV
RGVRVHNVLLNTRLAQSMDFLKENEYERHHLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacaaaaataatggggatattaaatgtgacacctgactcattttctgacgga
ggacagtaccactcagttgatcaagctgtgaagcgtgctaaagagatgatagatgaaggt
gtagacatcatagacgttggaggtgtctcaacacgaccaggtcataaagaagtatcgcat
aaagaagtatcgcttaaagaagaaatgaatcgtgtattgcctgtggttgagtctatcgtt
aaatatgatgtgcaaatttcggttgatacatttcgaagtgaagttgcggaagcttgtctt
aaacttggtgtttcaatgattaatgatcagtgggcaggcctatttgattcgaatatgttt
aatgtggtatctcaatacggtgctgaaattgtacttacgcataatggtgacggtcataga
gataaacctgttgttgaagagatgcttgtatcattacttgcgcaagcgaataaggctgaa
ctagccggtataccacataataaaatctggttagatcctggaataggttttcctaaaaca
cgagaagaagaaaatgaagtaatggcaagattagatgaattagtagcgaccgaatatcca
gttttacttgcaacaagtcgaaaaagatacattaaagaaatgatgaatcaagattcttct
ccttcagatagagatgaggcaactgcagctacaacggcttatggtataatgaaaggcgtt
cgtggggttcgagttcataatgtattattaaatacgcgactagcccaaagtatggatttt
ctaaaggagaatgaatatgaacgacatcatctttcttaa

DBGET integrated database retrieval system