KEGG   Staphylococcus epidermidis ATCC 12228: SE2305Help
Entry
SE2305            CDS       T00110                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SE2305 (recR)
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SE2305 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2382901..2383497)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVKFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPALVERLKNDEVKELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaagcttatcgatagttttatgaaactgccaggcatt
ggaccaaagacggctcaacgtctggcttttcatactttagatatgaaagaagacgatgtt
gttaagtttgctaaagcactagttgatgttaaaagagaacttacctattgtagtgtttgt
gggcatattacagaaaatgatccttgttatatatgtgaagataaacagcgagatcgttct
gtcatatgtgtagttgaagatgacaaggatgtcatagcaatggaaaaaatgcgtgaatat
aaaggtttatatcacgtgcttcatggttcgatttcaccaatggatggtattgggcctgaa
gacatcaatatacctgcattagttgaacgcctcaaaaacgatgaggtgaaagagcttata
ttagctatgaatcctaacctagaaggcgagtctactgcaatgtatatatctaggttggtt
aaaccaattgggattaaagtcacaagactggcacaaggtttatctgtaggcggcgattta
gaatatgctgatgaagtgactttatctaaagcaattgcaggtagaacggaaatgtaa

DBGET integrated database retrieval system