KEGG   Staphylococcus epidermidis ATCC 12228: SE2305Help
Entry
SE2305            CDS       T00110                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SE2305 (recR)
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SE2305 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2382901..2383497)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVKFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPALVERLKNDEVKELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaagcttatcgatagttttatgaaactgccaggcatt
ggaccaaagacggctcaacgtctggcttttcatactttagatatgaaagaagacgatgtt
gttaagtttgctaaagcactagttgatgttaaaagagaacttacctattgtagtgtttgt
gggcatattacagaaaatgatccttgttatatatgtgaagataaacagcgagatcgttct
gtcatatgtgtagttgaagatgacaaggatgtcatagcaatggaaaaaatgcgtgaatat
aaaggtttatatcacgtgcttcatggttcgatttcaccaatggatggtattgggcctgaa
gacatcaatatacctgcattagttgaacgcctcaaaaacgatgaggtgaaagagcttata
ttagctatgaatcctaacctagaaggcgagtctactgcaatgtatatatctaggttggtt
aaaccaattgggattaaagtcacaagactggcacaaggtttatctgtaggcggcgattta
gaatatgctgatgaagtgactttatctaaagcaattgcaggtagaacggaaatgtaa

DBGET integrated database retrieval system