KEGG   Staphylococcus epidermidis ATCC 12228: SE2364Help
Entry
SE2364            CDS       T00110                                 

Definition
(RefSeq) phosphoglycerate mutase Gpm3p
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00260  Glycine, serine and threonine metabolism
sep00680  Methane metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01230  Biosynthesis of amino acids
Module
sep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sep_M00002  Glycolysis, core module involving three-carbon compounds
sep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2364
  Energy metabolism
   00680 Methane metabolism
    SE2364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE2364
Enzymes [BR:sep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SE2364
Membrane trafficking [BR:sep04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SE2364
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SE2364
  Exosomal proteins of melanoma cells
   SE2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 1055696
NCBI-ProteinID: NP_765919
UniProt: A0A0H2VIJ2
Position
complement(2443376..2443966)
Genome map
AA seq 196 aa AA seqDB search
MEIYLVRHGESQSNYDNKHGYLYFCGQLDVPLTERGIKSAKELSVYFKNKYIDNIYLSDL
KRTRQTYEELFPYDIPTIYTKTLRERSLGVFEGENKEEVCKDKRFEKYFRDPNYKYFRHS
FSQKAPQGESYQDVYDRVVTFIENELNQQQKRVVIVAHQVVIRCFFVYFKMITKEEALAT
EIHNCYPYLIKKEMKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtgaggcatggtgagtcacagtccaattatgataataaacacggg
tatctatatttttgtggacagttagacgtccctttgacggaaaggggtataaaaagcgct
aaagaactatctgtttattttaaaaataaatacattgacaatatatatttatcagattta
aaaagaacaaggcaaacgtatgaggagctatttccttatgatattccaacaatatataca
aagacgttaagagagcgttcgttaggtgtttttgaaggggaaaataaagaagaagtttgt
aaagacaaacggttcgaaaaatatttccgtgatcctaattataaatactttagacatagc
ttttcgcaaaaagcaccacaaggagaaagttatcaagatgtctatgatagagtggttact
ttcattgaaaatgagcttaatcaacagcagaaacgtgtagtgatagttgcgcaccaagtt
gtaattagatgttttttcgtctattttaaaatgataactaaggaagaagccttagcgacg
gaaattcataattgctatccatatttaattaaaaaagaaatgaagttttga

DBGET integrated database retrieval system