KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_00460Help
Entry
SZO_00460         CDS       T00871                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SZO_00460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SZO_00460
  Lipid metabolism
   00071 Fatty acid degradation
    SZO_00460
  Amino acid metabolism
   00350 Tyrosine metabolism
    SZO_00460
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SZO_00460
   00626 Naphthalene degradation
    SZO_00460
Enzymes [BR:seq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SZO_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59035..60051
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGIVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcacatggtgattttggtcaggttccagggcgtatcctcggtcatgaa
ggtattggtattgttgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcactgtgaatattgtacaacaggtcgc
gaaaccctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgtgacagctgattacgctgtgaaagtaccagatggtcttgacccggctcag
gcatcatcgattacctgtgcaggtgttacaacctataaggctatcaaggaggcaggtgca
gctccaggacagtggattgttatttttggtgccggtggacttggtaacttagctgttcag
tatgctaaaaaggttttcaatgcccatgttgtagcagtggacattaacaacgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gcaggctatatccaagaaaaaacaggtggtgctcatggcatcgtagtaactgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctatcgtaaagactgtcctagacggaatcaag
gtagtcggatcacttgtgggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggcttggttgtaccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggtctcattcaaggaagaaaggtattggatttcacgctttaa

DBGET integrated database retrieval system