KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_00470Help
Entry
SZO_00470         CDS       T00871                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SZO_00470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SZO_00470
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SZO_00470
Enzymes [BR:seq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SZO_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60856..62340
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRNAANKVTASQAILSGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVAKLIL
SAFFDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGSTIAFKDMALSILP
YLLTTAAKKQGVERKIAILTATSGDTGKAAMAGFADVPGTDIIVFYPKSGVSRIQELQMI
TQAGHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVY
YIYAYAQLVRHQRLEAGETINIVVPTGNFGNLLAAYYAKEIGLPVAKFICASNENNVLTD
FFASGRYDKKRPFKVTTSPSMDILVSSNLERLVFHLLGNDAQKTASLMKSLAETGQYQLA
DADQSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTI
VASTASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVT
VADMQQAVEAYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgtaccaatcaacaagaaatgcagctaataaggtaacggctagtcaagcg
attttaagtggcctagcagacgatggtggcttgtttactcctacaagcatgccagtgctg
gatctagattttgaggagctaaagaccaagtcctatcaagaggttgccaagcttatttta
tcagccttttttgatgactatactgaagcagaattagatgcttgtatctcttctgcctat
gatgataagtttgatacagcagtgatagcacctctagctacgttaaaggattatcataat
ttggagctatttcatggctcaaccatcgcatttaaggacatggctctatctattttgcct
tatctcttgacaactgctgctaaaaagcaaggtgtggagcgaaaaattgcgattttaacc
gctacctcaggtgatactggtaaggcagcaatggcaggctttgctgatgttccgggaacg
gatattattgtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatc
acacaggccggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaa
acagaggtcaagcgcctgtttaatgaccctgatttgcgtgagcggctagcagctcaacag
atacagctgtcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctat
tatatttatgcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgatt
aacatagtagtgccgacaggaaattttggcaatctactggctgcctactacgccaaagaa
attggacttcctgttgccaaattcatctgtgcttccaatgaaaacaatgtcttgacagat
ttctttgctagtggtaggtatgataaaaagcgtcccttcaaggtgactactagtccatca
atggatattttggtgtcttcaaatttagagcgcttggtttttcatttactaggcaatgat
gcccaaaagacagcatcattaatgaagagcttggcagaaacaggtcagtatcagctagct
gatgcagatcagtctatccttgatttatttgcagcaggctttgcaacagagcaagagact
gctaaagagatcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagct
gtagcttcagctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactatt
gttgcgtcaactgctagtccttataagtttccgcgggtagttgtggaagctattagtggt
cagcaggttgccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtc
gtgccacaagctgtcaatggcttacaggaggcgcccattcgtcatagccttttagtgaca
gtagcagatatgcagcaggcagtggaggcttatcttggagtatag

DBGET integrated database retrieval system