KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_01720Help
Entry
SZO_01720         CDS       T00871                                 

Gene name
hasC1
Definition
UTP--glucose-1-phosphate uridylyltransferase 1
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SZO_01720 (hasC1)
   00052 Galactose metabolism
    SZO_01720 (hasC1)
   00500 Starch and sucrose metabolism
    SZO_01720 (hasC1)
   00520 Amino sugar and nucleotide sugar metabolism
    SZO_01720 (hasC1)
Enzymes [BR:seq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SZO_01720 (hasC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204123..205025
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAPQG
KAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILEKQAPGAGNEVQLTDAIDK
LNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIRLSKQLNKDVKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcactcgcttcctgccc
gccaccaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagccctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctatcgaggaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctgctcaagctcgttgatgagaccacagctatcaacctgcacttc
attcgtcagagccaccctagagggttaggggacgctgtcctccaagccaaggcctttgtg
ggcaatgagccctttgtggtcatgctgggggatgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagcttattgaggattatgattgcacacacgcctcaacgatt
gcagtgatgagggtaccgcatgaggaggtttccaattatggtgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtcctgatgag
gcgcctagtgacttagcgattattggacgttatttgttgacgcctgagatttttgccata
ttggagaagcaggcgcctggagctggcaatgaggtacagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgctagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactacgctctcaagcaccctcaggtcaag
gacgacctcactgactacattataaggctcagtaagcaactgaacaaggacgtcaagaaa
tag

DBGET integrated database retrieval system