KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_02960Help
Entry
SZO_02960         CDS       T00871                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SZO_02960
  Amino acid metabolism
   00300 Lysine biosynthesis
    SZO_02960
Enzymes [BR:seq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SZO_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354243..355613
Genome map
AA seq 456 aa AA seqDB search
MTKTDQQYLTRLWEDQLTQDYLVSLGQLIASRSIFAQGIGLEETAAYLKELFAQAGAEVI
VDKTYAAPFVLARFNSSRPAAKTLIFYHHYDTVPADNDQKWTSDPFTLTERDGYLFARGV
DDDKGHIIARLTAVVRYLKEHADLPLNIVFMMEGAEESASVDLDRYLAKYADQLKGAELL
IWEQGIRNEHDQLEITGGNKGILTFEMSVDSARCDIHSKYGGVIESAAWYLLQALSSLRN
HRGELLVPGIYQKVVPPTERELDLVETYAIENAQALKKLYGLELPMLQSERRQLLAAYYF
QPSINIQGLWTGYQGQGVKTIIPSQATAKLEVRLVPGLEPEYVFDQIRSYLLNKGFDQIK
LTYTLGEMSYRSDLSSSAIRQLVAVAEPLYPKGLSLLPTSAGTGPMHTVFEALQVPIAAF
GLGHSNSCDHAGDENIAIVDYCRHIALIEELITSYE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacggatcagcagtacttaacaaggctttgggaggatcagctcacacaggat
tatcttgtgtcgttggggcaattgattgccagtaggtctatttttgctcaaggtatcggc
ttagaagagacagcagcctatctaaaggagctgtttgctcaggctggtgctgaggttatt
gttgataagacttatgcagctccctttgtcctagcacgttttaatagctctaggccagct
gctaagacactgattttttatcatcattacgatacagtgccagcagataatgatcaaaaa
tggacaagcgatccctttaccttaacagagcgtgacggttatttatttgctcgaggtgtt
gatgatgataaggggcatatcattgcgagattgacggctgtcgtcaggtatctaaaggag
catgcagaccttccgcttaatattgtctttatgatggagggagctgaggagtcagcttcg
gtagatttagatcggtatctggctaaatacgcagaccagctaaagggagcagagcttttg
atttgggagcagggcattcgtaatgagcatgatcagcttgaaataactggcggcaataag
gggattttgacctttgagatgtcagtagatagtgctcgttgtgatattcattctaaatat
ggtggtgttatcgagtcagcagcctggtatttgcttcaggccctatcaagcctgcggaat
catcgcggggaattgctggtgcctggtatttatcaaaaagtcgttccgccaactgagcga
gagctagatttagttgagacctatgcaattgagaatgctcaagctctaaaaaagctttac
ggactggagcttcctatgttacaatcagagcgtcgtcaattgttagcagcttattacttt
cagccctccattaacattcaagggctgtggactggctatcaaggacaaggagttaagacc
atcattccttcacaggctactgctaaactggaggttcgtttggttcctggcttagagcct
gagtatgtctttgatcagattaggtcttatttgctcaataagggctttgaccagatcaag
ctgacctatactttgggtgagatgagctatcggagtgatctttcatcgtctgctattcgt
cagcttgttgcagtggctgagccgctttatcctaaggggctatctcttttgccgacatca
gcaggaacaggccctatgcatactgtttttgaagccctgcaggttccgattgccgctttt
ggcttagggcattctaatagttgtgatcatgcaggtgatgaaaacattgctattgtagat
tattgtcggcatattgcattaatagaggagttaataacatcttatgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system