KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_04600Help
Entry
SZO_04600         CDS       T00871                                 

Definition
glycosyl hydrolase family 2 protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SZO_04600
  Lipid metabolism
   00600 Sphingolipid metabolism
    SZO_04600
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SZO_04600
Enzymes [BR:seq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SZO_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536573..540016
Genome map
AA seq 1147 aa AA seqDB search
MSVDAITGPTDQSHGDTYQLHWIDKAGRCHAFSKGWRFLMADLQLAQEPFFDDSDWQQIA
LPHDFSINQPYTINGEAQSAYKLGGVGWYRKYFALDPKLADHKVYVTFDGAYMETQVYLN
GHLIGEHVNGYQAFSYDLSAFVIPGQENLLAVRVEHQVPSSRWYSGSGLYREAFLTVLPK
VHLDKDRLRLSLSQAALEADSQVLEIELGLSQQVSLGDYQLSLSLSEQLADTQQGQTVYE
SKPVALDLLEESGRLVMPISLRQIKLWSPAQPQLYQLDMLLYHKGAVLDRLTLETGFRQL
HFDAECGFFLNGKAFKLQGVCLHHDQGSLGACAYEEAIARQLVLLKEMGANTVRVTHNPS
ARRLKDLANRLGLFLIEEAFDTWTYAKNGNSHDFSSHFHKTVGHQNAARLKGVTTAETTW
AQYSIQAMVLSGLHDPAVLMWSIGNELLEGFSADVSHYPYVAKELCQWITELDQSRPITF
GDNKLKDKHFHWAQETKALAEQVNQLQSVQGVIGLNYAKARDYDRLHRDNPTWLLYGSET
ASAINSRGVYHLKGGASQDHELTSYDQSTVDWGSLASEAWYDTITRDFVAGECVWTGFDY
LGEPTPWNKIDSGAADQWPSPKQSYFGILDTAGFAKDSYYFYQSQWSKDKTTLHILPSWQ
EKDLELDDQGMVEVVVYSNAASVRLLFDDGHGGQIDYGIKTLIKHETPAGHCYQLYEGDD
AAELSHQNLYLTWKLPYRSGSLRAIAYDDKGQVITQTSGRSCVSSYQQPAQLFWSCFQLP
KLLAEPALLYLELSLLDANETLVLSANPVIKLEVEGPGACLALDNGDPRDHRPYTALSRR
AYGGKLLAIIALDGRAGQLRITARAAGFVEASYQLTVSEAAVKEKLLAYQLDKYSFIINK
TKRQLKAAPRPISQGSDDFAPAADYYVSCQSHCLSDRPVMMFSYATVFTEPLTFQPLTQR
LIKGRDIFLPNWLQPKTAAGQLFTKAFPIDWQLTEAVFSEESRVSGQTLCFGEALELEAI
LKSDTKGLRINQELSLVAKKKRLFQSDTQLSYRYQYDTVQAIGAISLTGLKKPLSSLRLV
LDYRSSTNAPSKQLILSLDQIEQPCHYIMLEEVVDVLSLDLTLEQPIGQAFDLARLQLGL
WSMAKEA
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagatgcaatcactggtccaacggatcaatctcatggggatacctatcagctt
cactggattgataaagcagggcgctgccatgccttttcaaaggggtggcgctttctgatg
gctgatttgcagctcgctcaggagccattttttgatgattcggactggcagcagatagct
ttaccacatgattttagcattaatcagccctatacgattaatggcgaagctcaaagtgcc
tataagctaggtggtgtaggctggtaccggaagtattttgcccttgatccaaagctggct
gaccataaggtttatgtgacctttgatggggcttatatggaaacacaggtataccttaat
ggtcatttgataggagagcatgtcaatggctatcaggcctttagctatgatctctcagcc
tttgtaatccctgggcaagagaatctattagcagttcgggttgaacatcaggtgcctagc
tcgcgttggtattctggaagcgggctttatcgggaggcttttttgaccgttcttcctaag
gttcatcttgataaggatcggcttcgtttatccttatcccaggcagcgcttgaggctgat
agtcaagtactggagatagagcttggactaagccaacaggtctccttgggtgactatcag
cttagccttagtctatctgagcagctggcagatacccagcaagggcagacagtatatgag
agtaaaccggtagctttggacctcttggaggagtcaggtaggctggtgatgcccatttcc
cttaggcagataaagctgtggtcaccagctcagccccagctctatcagcttgatatgctt
ctttaccacaagggagcagtgcttgatcggctgacacttgaaacaggctttcgacagctg
cattttgatgctgagtgtggtttctttttgaatggcaaagcctttaagctgcaaggggtc
tgtcttcatcatgatcagggtagcctgggggcatgtgcttatgaggaagctatagctagg
cagcttgttttgctaaaggaaatgggagcaaatacggttcgtgtcacgcacaaccctagt
gccagaaggcttaaggatctggctaacaggcttggattatttctcattgaggaagccttt
gatacctggacttatgctaaaaacggtaatagccatgatttttcaagccattttcacaag
acagtgggacaccaaaatgcagccaggctaaagggagtcactacagcagaaaccacctgg
gcgcaatatagcatacaggccatggttctctcaggccttcacgatccagctgttttgatg
tggtcaatcggcaatgaattgttagaaggcttctcagctgatgtgagccactacccttat
gttgctaaggagctatgccagtggatcactgagctggatcagtcaagacctattaccttt
ggggataataagctcaaggacaagcattttcattgggcgcaggaaacaaaagcgttggca
gagcaggtcaatcagctccagtccgtgcaaggagtgattggacttaactatgctaaggcc
agagattatgatcgattgcatagggacaacccgacttggctgctttatggctcagagaca
gcctctgctattaatagtagaggggtctatcatctcaagggaggagctagtcaggatcat
gagctaacctcctatgaccagtcaacggttgactggggatccttagctagtgaggcttgg
tatgatacaatcacaagggattttgttgcaggtgagtgtgtttggacgggctttgattat
ctaggggagcctactccttggaacaagattgactcaggcgcagctgatcagtggccgtcg
cccaagcaatcctactttggtattttagatactgctggatttgctaaggatagctattat
ttctaccaaagccaatggtcaaaagataaaacgacacttcatattctgcctagctggcag
gaaaaggaccttgagctagatgatcagggcatggtggaggtcgtggtttatagtaatgct
gctagtgtgaggctactttttgatgatggtcatggagggcagattgattatggcatcaag
accttgataaagcatgaaacaccagcaggccattgctaccagctatatgagggtgacgat
gcagcagaattatctcatcaaaacctttacctgacctggaagcttccttatcgctctggg
agcttgagggctattgcttatgatgataagggacaggtgatcacacaaaccagtggtcgt
tcctgcgtgagcagctaccagcagcctgctcagcttttctggtcctgctttcagcttcct
aagctgcttgcagagcctgcgctactttatcttgaattgtctttgttagatgctaatgag
accttggtgctcagtgctaatcctgtgattaagcttgaggttgagggtcctggagcctgc
cttgctctggataatggtgaccctcgtgaccataggccctatactgccttgtcacgccga
gcatatggtggcaagctattagccattattgctcttgatggtcgtgcgggtcagcttaga
ataacagctagagccgcaggattcgtggaagccagctatcagttgacggtttctgaagca
gccgttaaggagaagcttttagcctatcagcttgataaatacagctttatcattaacaag
acgaaaaggcagctcaaggcagctccaaggccaatcagccaaggctctgatgacttcgca
cctgctgctgattactatgtatcatgccaaagtcactgcttgtctgataggcctgtgatg
atgtttagctatgctacggtatttacagagccattgacctttcagcctctgacgcaaaga
ctgataaaggggagggatatctttctgccaaactggctacagcctaaaacagctgctggc
cagttatttaccaaggcttttcctattgattggcagctaacagaggcagttttttctgag
gagtcaagggttagtgggcagaccctttgttttggagaggctttggagcttgaagctatc
cttaagtcagatacaaaaggattaaggatcaatcaagagcttagcttagttgctaaaaag
aagcggctgtttcagagtgatacccagcttagctaccgctatcaatacgataccgtacag
gccattggtgccattagcctgacaggactaaagaagcccttaagctcgcttaggcttgtt
ttggactatcgcagcagcaccaatgcgccatcaaaacagctgatcctatcgcttgatcag
atagaacagccctgtcactatatcatgctggaagaagtagttgatgtgctaagcctagac
ctaacattagagcagccgatcggacaggcttttgacttagctaggcttcagctaggcctt
tggagcatggctaaggaggcttag

DBGET integrated database retrieval system