KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05220Help
Entry
SZO_05220         CDS       T00871                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SZO_05220
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SZO_05220
Enzymes [BR:seq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SZO_05220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603794..604567
Genome map
AA seq 257 aa AA seqDB search
MSKQVVFVTGAASGIGKQIGETFLKEGKIVVFSDINQEKLDAVVDEYTTKGWAADCVLCD
VTNEEAINKAIDYTVEKHGRLDILVNNAGLQHVAMIEDFPTAKYEFMLKVMLTAPFIAIK
RAFPTMKKQGFGRVINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADLGITVNAI
CPGYVDTPLVRGQFEDLSKTRKIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASDKA
KGITGQPVILDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaagtagtattcgtaacaggtgcagcaagcggtattggtaaacaaattggt
gaaaccttcttgaaagagggcaaaatcgttgtcttttcagatatcaatcaagaaaaatta
gatgctgttgttgatgagtataccacaaaaggatgggcagcggattgtgttttgtgtgat
gtgacaaatgaagaagcgatcaataaagcgattgattatacagttgaaaaacatggtcgt
ttggatattttggtcaacaacgcaggtttgcagcatgttgccatgattgaagattttcca
acagcaaaatatgaatttatgttgaaggtcatgttgacagcgccatttatcgctattaaa
cgcgctttcccaaccatgaaaaagcaaggctttggtcgtgtcattaatatggcttctatc
aatggtgtcattggttttgctggaaaagcggcttacaattcagcaaaacatggtttgatt
ggcttgacaaaggttgcagcgcttgaagccgcagatttaggtatcacagtcaacgctatc
tgtccaggttatgtagacacaccactcgttcgtggtcaatttgaagacctctctaaaaca
cgtaagattccactcgaaaatgtattggaagaagtgttgtacccgttggtaccgcaaaaa
cgtttgattgacgtacaagaaattgcagattatgtctccttccttgcaagtgataaggca
aagggtatcactggtcaaccggttatcttagatggtggctacaccgctcaataa

DBGET integrated database retrieval system