KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05330Help
Entry
SZO_05330         CDS       T00871                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:seq00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SZO_05330
Enzymes [BR:seq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SZO_05330
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SZO_05330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619785..620630
Genome map
AA seq 281 aa AA seqDB search
MLARLVSLIMPELPEVETVRRGLERLVVGKQIAAVTVKVPKMVKTDLEHFVMTIPGQQVQ
GVDRRGKYLLFDFGQLVMISHLRMEGKYLLFADTVPDHKHFHVFLTMTDGSTLVYQDVRK
FGTFELLPKSELAAFFQKRQLGPEPTKQAFRLKPFEAALLASRKSIKPHLLDQTLVAGLG
NIYVDEVLWAAKVHPERRSASLKKAEIKRIHDETIRILQLGIEKGGSTVRTYQNTLGMNG
SMQHYLMVYGQTGKPCQRCGAAIVKLKVGGRGTHVCPRCQR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgttagcgcgtttggtatctttaattatgcctgaactccctgaggttgagacagtgcga
cgcgggcttgagcgcttagtcgttggcaagcagattgcagcagtgacagttaaggtgcct
aaaatggtcaaaacagaccttgagcattttgtgatgacgatccctgggcagcaggtgcaa
ggggtggatcgtcgtgggaagtacctgctctttgactttggtcagctggttatgatttcg
cacttacgtatggagggcaaatacctcttgtttgctgatacagtgcctgatcacaagcat
tttcatgtgtttttgaccatgactgatggctccaccttggtttatcaagatgtcagaaag
tttggaacctttgagctgctgccaaaatctgagctggctgccttttttcagaagcgtcag
cttggtcctgagcctaccaagcaagcctttcgcttaaagccctttgaagctgctctgctt
gcgtctagaaagagcattaagccccaccttttggatcagactctggtggctggccttggc
aatatctatgtagatgaggttctatgggcggccaaggtccaccctgagcgtcggtctgct
agtctaaaaaaagcggaaatcaaacggatccatgatgagaccattcgtattttacagcta
ggtattgaaaagggtggctcgacggttaggacctatcaaaataccttgggaatgaatggc
agtatgcagcactacttgatggtttatggtcaaacaggcaagccctgtcagcgctgtggt
gcagctattgtgaaattaaaggttggagggagagggacacatgtctgtcctaggtgtcaa
cgataa

DBGET integrated database retrieval system