KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05330Help
Entry
SZO_05330         CDS       T00871                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:seq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619785..620630
Genome map
AA seq 281 aa AA seqDB search
MLARLVSLIMPELPEVETVRRGLERLVVGKQIAAVTVKVPKMVKTDLEHFVMTIPGQQVQ
GVDRRGKYLLFDFGQLVMISHLRMEGKYLLFADTVPDHKHFHVFLTMTDGSTLVYQDVRK
FGTFELLPKSELAAFFQKRQLGPEPTKQAFRLKPFEAALLASRKSIKPHLLDQTLVAGLG
NIYVDEVLWAAKVHPERRSASLKKAEIKRIHDETIRILQLGIEKGGSTVRTYQNTLGMNG
SMQHYLMVYGQTGKPCQRCGAAIVKLKVGGRGTHVCPRCQR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgttagcgcgtttggtatctttaattatgcctgaactccctgaggttgagacagtgcga
cgcgggcttgagcgcttagtcgttggcaagcagattgcagcagtgacagttaaggtgcct
aaaatggtcaaaacagaccttgagcattttgtgatgacgatccctgggcagcaggtgcaa
ggggtggatcgtcgtgggaagtacctgctctttgactttggtcagctggttatgatttcg
cacttacgtatggagggcaaatacctcttgtttgctgatacagtgcctgatcacaagcat
tttcatgtgtttttgaccatgactgatggctccaccttggtttatcaagatgtcagaaag
tttggaacctttgagctgctgccaaaatctgagctggctgccttttttcagaagcgtcag
cttggtcctgagcctaccaagcaagcctttcgcttaaagccctttgaagctgctctgctt
gcgtctagaaagagcattaagccccaccttttggatcagactctggtggctggccttggc
aatatctatgtagatgaggttctatgggcggccaaggtccaccctgagcgtcggtctgct
agtctaaaaaaagcggaaatcaaacggatccatgatgagaccattcgtattttacagcta
ggtattgaaaagggtggctcgacggttaggacctatcaaaataccttgggaatgaatggc
agtatgcagcactacttgatggtttatggtcaaacaggcaagccctgtcagcgctgtggt
gcagctattgtgaaattaaaggttggagggagagggacacatgtctgtcctaggtgtcaa
cgataa

DBGET integrated database retrieval system