KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_07090Help
Entry
SZO_07090         CDS       T00871                                 

Definition
(GenBank) putative 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00500  Starch and sucrose metabolism
seq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SZO_07090
Enzymes [BR:seq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SZO_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CAW98818
UniProt: C0MDJ2
Position
806977..808479
Genome map
AA seq 500 aa AA seqDB search
MTKRASGILMHISSLPGRFGIGSFGKEAFEFVDFLKETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDLELLAKDGYLQEADYAAVDFGSNPESVDYAQVFQARRPLLEKAVQAFV
STEEGLRQLAEFEATASWLNDFAEFMAIKEHFDHKALQEWDDRAIVKREEAALLHYRKLL
AKGITYHKVCQYFFYQQWLALKAYANQNGIAIIGDMPIYVSADSVEVWTMPELFKVDADK
KPIYIAGVPADGFSEDGQLWGNPIYNWESHEQTGFAWWIHRIKESFKLYDKLRIDHFKGF
SDFWEIPGGDVTAKNGHWESAPGIALFTAVREALGDLPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDVTSQSFDLPHHYDHNCIVYTGTHDNEVVNGWYEHLSAEQVEFVNHYIH
KTADESITKAMLRTIFATVCDTAILCMQDLLDKSADSRMNMPNTVGGNWQWRMLEDDIKA
EHKAYLIHLTELYGRANNHH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacgtgcaagtggtattctgatgcatatcagctcgcttccgggacgcttcggt
attgggagttttggtaaagaggcctttgaatttgttgactttttaaaggaaaccaagcag
acctattggcagattttgcccttaacaacaactagctttggagattctccttatcaatct
ttttcagctattgcaggaaatacgcattttattgaccttgaattgctagcaaaggacggt
tatttgcaggaagctgattatgctgctgttgattttggctcaaatccggagtctgttgat
tacgctcaagtctttcaagccagacgccctttattagaaaaagcagttcaggcttttgtc
tcaactgaggaaggcttaagacagctcgccgaatttgaagcaactgcgagctggctaaat
gattttgccgaatttatggctattaaagagcattttgatcacaaagccctccaggaatgg
gacgatagagcaattgttaagcgtgaagaggctgctttgctccattaccgcaagctgttg
gccaaaggcatcacctatcataaggtctgccaatatttcttttaccagcaatggctagcc
ctaaaggcctatgctaatcaaaatggcattgctatcattggtgatatgccaatctacgtg
tctgctgatagcgttgaggtttggacgatgccagagctctttaaggtggatgcagataaa
aagccgatttacattgcaggtgtacctgctgatggctttagtgaggacgggcagctttgg
ggcaatcctatttacaactgggagagccatgagcaaacaggctttgcttggtggatccat
cggatcaaagagagcttcaagctgtacgataagcttagaattgaccatttcaagggcttc
tcagatttttgggaaattcctggtggtgatgtgactgctaaaaatggtcattgggagtca
gcccctggaattgccttgttcacagctgtcagagaagctttgggtgatttgccaattatc
gcagaaaatcttggctacattgatgaaaaggcagagcagctgcttgcctcaactggattt
ccaggcatgaaaattttagagtttggcttgtttgatgtgacgagtcaaagctttgatttg
ccgcatcattatgatcacaattgcattgtctacactggtacgcatgacaatgaggtggtt
aatggctggtatgagcatttgagcgcagagcaggttgagtttgttaatcattatattcat
aagacagctgatgaaagtattaccaaggccatgctaagaacaatctttgcaactgtttgt
gatactgctatcttgtgcatgcaggatttgctggataagtcagctgatagccgcatgaat
atgccaaacactgtcggtggtaactggcagtggcgcatgcttgaggacgatattaaagca
gagcacaaggcctatttaatccatttgactgagctatatggtcgagccaataatcatcac
tag

DBGET integrated database retrieval system