KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_07270Help
Entry
SZO_07270         CDS       T00871                                 

Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SZO_07270
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SZO_07270
Enzymes [BR:seq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SZO_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824811..825410
Genome map
AA seq 199 aa AA seqDB search
MMTEQFFDKALACREIEAIPGLLEFDIPVRGDNRGWFKENFQKEKMIPLGFPEQFFAAGK
LQNNISFSRKHVLRGLHAEPWDKYISVADEGKVLGAWVDLREGDSFGHTYQTVIDASKGI
FVPRGVANGFQVLTDKVAYTYLVNDYWALELKPKYAFVNYADPSLGIAWENLEQAEVSEA
DKSHPFLEAVKPLRQEDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacagaacaattttttgataaagccttagcctgtcgggaaattgaagccattcct
ggacttttggagtttgatatccctgttcgaggggacaatcgtggctggtttaaggaaaat
tttcaaaaggaaaaaatgattcctctaggctttcctgagcagttttttgccgcaggtaag
ctgcaaaacaatatttcattttcgcgcaagcatgtgcttcgaggcctgcatgcagagcct
tgggacaagtacatctctgttgctgatgagggtaaggttcttggagcttgggttgatctt
cgtgagggtgatagctttgggcatacctatcaaacagtcattgacgcttcaaaggggatt
tttgtccctcgaggtgttgctaatggctttcaagtactgactgataaggtggcttatacc
tatctggtcaatgattattgggcgcttgagctcaagccaaaatatgcctttgttaattat
gctgacccaagccttgggattgcgtgggaaaatcttgaacaagcagaggtttcagaagca
gataaaagccatcccttcctagaggccgttaagcctttgagacaagaagatttatcataa

DBGET integrated database retrieval system