KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_08460Help
Entry
SZO_08460         CDS       T00871                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:seq00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:seq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944229..945164
Genome map
AA seq 311 aa AA seqDB search
MSVVNNRVALKHLVSMEHLTNEEVMGLISRGSEYKAGKVAIKDNSRHFAANLFFENSTRT
HKSFEVAENKLGLRVLDFNADTSAVNKGETLYDTVLTMSALGTEICVIRHPEDDYYQQLI
DSPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGHFDGLKIAIAGDLTHSRVAKSNMQI
LKRLGAELYFYGPEQWYSSEFDSYGRYMAIDHIIDQLDVLMLLRVQHERHDGSQSFSKED
YHRQFGLTEERYRRLKDSAIIMHPAPVNRDVEIADHLVEAPKARIVAQMANGVFVRMAII
EAILNGRNENV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgtaaataatcgtgttgcgcttaagcatttggtgtcaatggagcatttaaca
aatgaagaggttatgggacttattagtcgtggctctgaatacaaggcaggtaaggtagct
attaaagataacagtaggcactttgcagctaatttattctttgaaaattcaacaagaacc
cataaatcctttgaggttgctgagaataagcttggtcttagagtccttgattttaacgct
gatacaagtgctgtcaataagggggaaaccttatatgatactgttcttactatgagtgct
ctaggaacagaaatctgcgtgattcgtcacccagaagatgattactatcagcagcttatt
gacagtccaacgattactgcctctatcgttaatggaggtgatggatcaggtcagcaccct
agtcaatgcttgcttgatttgctaactatttatgaagaatttggtcattttgatggcctg
aagattgctattgcaggggatttgacacattctcgtgtggctaagtcaaacatgcagatt
ctaaagcggcttggagcagagctttatttctatggtcctgagcaatggtactcgtctgaa
tttgacagctatggaaggtacatggcgattgatcacattattgatcaattagatgtgttg
atgctgcttagggtgcagcatgagcgccatgatggtagtcaaagcttttcaaaggaagat
tatcatagacagtttggcctaactgaggagcgctacaggcgattaaaggactctgcgatt
attatgcacccggcaccggttaatcgcgatgttgagattgctgaccatttagtagaggct
ccaaaggcaagaatagtagctcaaatggctaatggtgtctttgtccgtatggccattatc
gaagcgatccttaatggcagaaacgaaaacgtctaa

DBGET integrated database retrieval system