KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_08900Help
Entry
SZO_08900         CDS       T00871                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:seq00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:seq00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000136..1000633
Genome map
AA seq 165 aa AA seqDB search
MTKKIIAIWAEDEAGLIGACGRLPWYLPKELQHFKETTLNQAILMGRVTFEGMKGRLLPN
RQTLVMTRDSYYHVEGVLTITSVQEALDWYHAQDKTLYVIGGSKVLEAFDGHFDVIIKTV
VHHQFEGDTYRPRLELSGFVEETSVLYLRDDNNPYDFTVTVLRHR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaagattattgctatttgggcagaggatgaagcaggacttatcggagcgtgt
ggcaggcttccttggtacctaccaaaagagttgcagcatttcaaggaaacaacattgaat
caagctatcctgatgggacgagtaacctttgagggcatgaaggggcgtttgctgccaaat
cgccaaacgcttgttatgaccagagacagttattatcatgtggagggcgttttaaccata
accagtgtgcaggaggctttggattggtatcatgcgcaggataagaccttatatgtgatt
ggtggcagcaaggttttagaggcctttgatggtcattttgatgtcatcatcaaaacagtg
gtacatcaccagtttgagggtgatacctaccgacctaggttagagctgagtggttttgtg
gaggagacctctgtgttgtacctaagggacgataacaatccttacgatttcactgttaca
gtattgagacatcgctaa

DBGET integrated database retrieval system