KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_09030Help
Entry
SZO_09030         CDS       T00871                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SZO_09030
Enzymes [BR:seq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SZO_09030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016085..1016885
Genome map
AA seq 266 aa AA seqDB search
MTIRRYSAAGEAAIMGILNVTPDSFSDGGSYTSVDQALAQAEKMLSEGATVIDIGGESTR
PGFQFVPAEEEIARVVPVIKAIKKQYDVLISIDTYKTETARAALEAGADMLNDVWAGLYD
GQMLSLAAEYDVPIILMHNQTKEAYADVTKEVCSFLQARAAAALKVGVKKEHIWLDPGFG
FAKNVEQNIALLKGLSEVCQLGYPVLFGISRKRVVDALLGGGTKAKDRDGATAALSAYAI
NKGCQMVRVHNVGANRDIVSVLSQLR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactatcagacgttattcagctgctggtgaagcagctattatggggattttaaatgtg
actccggattcgttttcagatggtggctcctatactagtgtcgatcaggcattggcacag
gccgaaaaaatgttgtcagaaggagcgactgtcattgatattggaggtgagtcaacacga
ccgggcttccaatttgtgccggcagaagaagagattgcacgtgttgttccagtcataaag
gccatcaaaaaacagtatgatgtccttatcagcattgatacctacaagacagaaactgct
agagcggcccttgaagcaggagcagatatgctcaatgatgtctgggcaggactatatgac
ggtcaaatgctaagtctagccgccgaatacgacgttcccattatattaatgcataatcaa
accaaagaggcttatgctgatgttacaaaagaggtttgcagctttttacaggctagagca
gctgcagctctcaaagtaggtgtcaaaaaagaacatatctggcttgatccaggatttggc
tttgctaaaaatgttgagcaaaatatagccttattaaaggggctgagtgaggtttgtcag
ctaggctaccctgttctttttgggatttccagaaagcgcgttgtagacgctctacttggt
ggcggcactaaagccaaggatcgtgacggggctactgctgccttatcagcctacgctatt
aataaggggtgtcaaatggtgcgtgtgcataatgtcggtgctaacagggatattgtctct
gtattgagtcaattaaggtga

DBGET integrated database retrieval system