KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_09050Help
Entry
SZO_09050         CDS       T00871                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:seq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017248..1017754
Genome map
AA seq 168 aa AA seqDB search
MTLVYLGLGTNMGDRAGYLQAAVTALSRLPETELLRQSSIYQTAAWGKKDQNDFLNMVCQ
LDTKLTPEALLAATQAIEQDLGRVRHEKWGPRTIDIDLLLFGDEPYQSKALTIPHPYMTQ
RAFVLIPLLEIAPDVTLPGSQKNLRSYLDALEQSDVALWSHEYSNKFS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtttatttaggcttgggaactaatatgggagatagagcaggctacctacag
gcagcagttactgccctatctaggctgccagagactgagttactgagacaatcctctatc
tatcaaacagcagcttggggaaaaaaggatcaaaatgattttttgaatatggtctgtcag
ctagatactaagctgacaccagaagctcttttagcagctacccaggctatcgagcaggat
ctaggacgggttcgacatgaaaaatggggaccaaggacaattgatattgacctcttgctg
tttggtgatgagccttaccagtccaaggccttgacgattcctcacccctatatgacgcaa
agagcctttgttttgattcctttattagagattgcacccgatgtgaccttacctggtagc
cagaaaaacctgaggtcttaccttgatgctttagagcaatcagatgtagccttgtggtca
catgagtattcaaataagttttcttaa

DBGET integrated database retrieval system