KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_10220Help
Entry
SZO_10220         CDS       T00871                                 

Definition
ABC transporter permease
Orthology
K02057  
simple sugar transport system permease protein
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1143045..1144109)
Genome map
AA seq 354 aa AA seqDB search
MSKNAQKIAVPMISILLGFLLGAIVMFIFGYDPIWGYEGLFQVAFGSIKNIGEIFRAMGP
LILIALGFTVASRAGFFNVGLSGQALAGWIAAGWFALVNPNMPRPLLILMTVLIGMVAGG
IAGAIPGILRAYLGTSEVIVTIMMNYIILYVGNAIIQRGYPESVKQSIDSTIQVSDNASY
QSQWLSDLTNNSRINIGIFFALIAIAVIWFLLNKTTLGFEIRSVGLNPHASEYAGMSSKR
TIILSMIISGALAGLGGVVEGLGTFENVFVQGSSLAIGFDGMAVSLLAANSPIGIFFSSF
LFGVLSIGAPGMNIAGIPPELVKVVTASIIFFVGAHYLIERYIIRPKKLVKGGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaatgcacaaaagattgctgtgccaatgatttctatcttgttaggattctta
cttggcgctattgtcatgtttatctttggctatgatccaatttggggctatgagggccta
tttcaggtagcctttggtagtatcaaaaatattggtgaaatcttcagagcgatgggacca
ctaatcctgattgcacttggttttaccgttgctagccgtgccggcttctttaatgtcggg
ctgtcaggtcaagctttggctggttggattgctgcgggctggtttgctcttgtcaatcct
aatatgcctcgtccgcttttaattctgatgactgtcttgattggtatggttgccggcgga
attgctggcgctattccaggtattttgcgagcttatcttggtacgagtgaagttattgtt
accattatgatgaattatattattctgtatgtcggtaacgctatcattcaaagaggctac
cctgaaagtgttaagcaaagtattgattcaaccatacaggtcagtgataatgccagctat
caaagtcaatggctgtcagatttaaccaataattctcgtattaatatcggtatctttttt
gcgcttattgcaattgcagttatttggttcttgctaaacaaaacaaccctcggatttgaa
attcgttcagtaggtcttaatccacatgcttcagaatatgcaggtatgtcctcaaagcgt
acgattatcctatcaatgatcatttcaggtgctttggcaggcttgggaggagttgttgaa
ggcttgggaacctttgagaatgtttttgtacagggaagctctctagcaattggttttgac
ggtatggctgttagcttgcttgctgccaattcaccgattggtatcttcttctcatcattc
ctatttggggtgttgagcataggtgctcctggtatgaatatcgcaggaattccaccagaa
ttggtaaaagtagtgactgcctcaattatcttctttgtaggtgctcactaccttatcgaa
cgctatattatcaggcctaaaaaactagtaaagggaggtaaataa

DBGET integrated database retrieval system