KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_10220Help
Entry
SZO_10220         CDS       T00871                                 

Definition
ABC transporter permease
Orthology
K02057  
simple sugar transport system permease protein
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1143045..1144109)
Genome map
AA seq 354 aa AA seqDB search
MSKNAQKIAVPMISILLGFLLGAIVMFIFGYDPIWGYEGLFQVAFGSIKNIGEIFRAMGP
LILIALGFTVASRAGFFNVGLSGQALAGWIAAGWFALVNPNMPRPLLILMTVLIGMVAGG
IAGAIPGILRAYLGTSEVIVTIMMNYIILYVGNAIIQRGYPESVKQSIDSTIQVSDNASY
QSQWLSDLTNNSRINIGIFFALIAIAVIWFLLNKTTLGFEIRSVGLNPHASEYAGMSSKR
TIILSMIISGALAGLGGVVEGLGTFENVFVQGSSLAIGFDGMAVSLLAANSPIGIFFSSF
LFGVLSIGAPGMNIAGIPPELVKVVTASIIFFVGAHYLIERYIIRPKKLVKGGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaatgcacaaaagattgctgtgccaatgatttctatcttgttaggattctta
cttggcgctattgtcatgtttatctttggctatgatccaatttggggctatgagggccta
tttcaggtagcctttggtagtatcaaaaatattggtgaaatcttcagagcgatgggacca
ctaatcctgattgcacttggttttaccgttgctagccgtgccggcttctttaatgtcggg
ctgtcaggtcaagctttggctggttggattgctgcgggctggtttgctcttgtcaatcct
aatatgcctcgtccgcttttaattctgatgactgtcttgattggtatggttgccggcgga
attgctggcgctattccaggtattttgcgagcttatcttggtacgagtgaagttattgtt
accattatgatgaattatattattctgtatgtcggtaacgctatcattcaaagaggctac
cctgaaagtgttaagcaaagtattgattcaaccatacaggtcagtgataatgccagctat
caaagtcaatggctgtcagatttaaccaataattctcgtattaatatcggtatctttttt
gcgcttattgcaattgcagttatttggttcttgctaaacaaaacaaccctcggatttgaa
attcgttcagtaggtcttaatccacatgcttcagaatatgcaggtatgtcctcaaagcgt
acgattatcctatcaatgatcatttcaggtgctttggcaggcttgggaggagttgttgaa
ggcttgggaacctttgagaatgtttttgtacagggaagctctctagcaattggttttgac
ggtatggctgttagcttgcttgctgccaattcaccgattggtatcttcttctcatcattc
ctatttggggtgttgagcataggtgctcctggtatgaatatcgcaggaattccaccagaa
ttggtaaaagtagtgactgcctcaattatcttctttgtaggtgctcactaccttatcgaa
cgctatattatcaggcctaaaaaactagtaaagggaggtaaataa

DBGET integrated database retrieval system