KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_10830Help
Entry
SZO_10830         CDS       T00871                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SZO_10830
   01230 Biosynthesis of amino acids
    SZO_10830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SZO_10830
   00030 Pentose phosphate pathway
    SZO_10830
   00051 Fructose and mannose metabolism
    SZO_10830
   00052 Galactose metabolism
    SZO_10830
  Energy metabolism
   00680 Methane metabolism
    SZO_10830
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SZO_10830
Enzymes [BR:seq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SZO_10830
Protein phosphatases and associated proteins [BR:seq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SZO_10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196114..1197127)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIHKVVSTIKDDFENRGKNHHIIVLAEGVMSGEAFAQQLKEAGD
ESDLRVTNLGHILRGGSPTARDRVIASWMGAHAVELLKEGKGGLAVGIRNEELVESPILG
SAEDGALFSLTDEGNIVVNNPHKARLDYAALNRSLAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgacgcccctggtatgaatgctgctatt
cgtgcagttgttcgtaaagcaatttcagaaggaatggaagtctatggtattaaccgcggc
tatgctggtatggttgatggtgatatctttccactaggctcaaaagaggttggtgataag
atttctcgcggcgggaccttcctttattcagctcgctatccagagtttgctcagcttgag
gggcaattggctggtattgagcagctaaaaaagcatggcattgaaggggtagttgtcatt
ggtggtgatggttcttaccatggtgcgatgcgcttgactgagcatggcttccctgcagta
ggtatcccagggacgattgataacgatattgctggaacagactatactatcggatttgac
actgcggtcaatactgcggtagaggctattgataagcttcgcgatacctcatcaagtcat
ggacggacctttgttgttgaagtgatgggacgtaatgcaggtgatatcgcactttgggca
ggtattgcaagtggagcagatcaaatcatcgttcctgaagaggaatttgacattcataaa
gtggtctcaacaattaaagacgattttgaaaatagaggaaaaaatcaccatattatcgtt
ttagctgagggcgttatgagtggcgaggcctttgcgcagcagctaaaagaagctggagat
gaaagtgaccttcgtgtgacaaaccttggtcatatccttcgcggtggctctccgactgcg
cgtgatcgtgtgattgcgtcatggatgggagcgcacgctgttgagctgctcaaggaaggc
aaaggcggcttggctgttggtatccgtaacgaagagcttgttgaaagtccgattcttgga
agtgcagaggacggtgccttgttcagccttactgatgagggcaacattgttgttaataac
ccgcacaaggctcgcttagactacgctgctttgaaccgttcattagcacaatag

DBGET integrated database retrieval system