KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_11740Help
Entry
SZO_11740         CDS       T00871                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SZO_11740
Enzymes [BR:seq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SZO_11740
Exosome [BR:seq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SZO_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303009..1304889)
Genome map
AA seq 626 aa AA seqDB search
MDNDLALYTFGTGENFHVQDYLGVHRINNDTGTSYVFRVWAPNAEAVSLIGDFTDWQSNP
LEMTRNEAGVWELVTSLPHEGDIYKYWVRRQGGQLVEKIDPVAFLFEARPGTGAIVKTLP
AKKWRDSLWMGRRKRFGFRQRPVNIYEVHAHSWKKDENARPYDFSKLKEELIPYLKSMHY
THVEFMPVMAHPLDMSWGYQLMGYFAFESTFGSPEAFQDFVEACHLNNIGVLIDWVPGHF
TQNDDALAYFDGTATYEYQDHHRAHNYGWGALNFDLGKTQVQSFLISSALFWLEAYHVDG
IRVDAVSNMLYLDYDQGPWTPNQYGGNQNLEGIAFLQKLTTVIKEKHPDVMMIAEEATSA
TPITSPVAEGGLGFDYKWNMGWMNDILRFYEEDPYYRKYDFNLLTFSFMYCFKEHYILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDHQ
LEWQNLEDELNAKMQYFTASLNQLYKAHSMLWQNDETYDGIDIIDADNKDESVLSFCRQN
NKGELLLCVFNMTPVERPDFTIGVPIAGLYQEIFNTELEAFGGVWKEHNPLTSTVAKKWK
TYPQALSFTLPALGASIWKIKRRRKQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggataatgacttagcgctttatacctttggcacaggtgagaatttccatgtacaggat
tatctaggtgttcatcggattaacaatgacacaggtaccagctatgtctttagggtatgg
gcgcccaatgcagaggctgtcagcttgattggagattttactgattggcagtccaatcca
cttgagatgacacgaaatgaggctggtgtgtgggagcttgtcactagtctgcctcatgaa
ggagatatttataagtactgggttaggcgccaaggtggtcagcttgttgaaaaaattgat
ccagtggcctttctatttgaagctagaccaggaacgggtgctattgtcaaaacccttcca
gccaaaaaatggcgtgatagcttatggatgggacggcgaaagcgttttggctttaggcag
cgtccagttaatatttacgaggttcatgcccattcatggaaaaaagacgaaaacgcaagg
ccttatgactttagcaagctaaaagaagagctcattccctatctcaagagcatgcactac
actcatgttgaatttatgccggtcatggctcaccccttagacatgagctggggttatcag
ctgatgggttactttgcctttgagtcaacctttggaagcccagaagcctttcaggatttt
gttgaggcctgtcatcttaataatattggtgtcttgatcgactgggtcccagggcatttt
acacaaaatgatgacgccttagcttattttgacggtacagctacctatgaatatcaggat
caccatcgtgctcataattatggctggggggccctaaattttgatttgggtaaaactcag
gtacagtcctttttgatttcaagtgcccttttttggctggaggcttatcatgttgatggt
attcgagtagatgctgttagcaatatgctttacttggattatgatcagggtccttggact
cccaatcaatacggtggcaaccaaaaccttgaggggatagcctttcttcaaaaattaacc
acagttatcaaggaaaaacaccctgatgtgatgatgattgcagaggaggcgacctcagct
accccaataaccagccctgttgcagaagggggactaggctttgattataagtggaatatg
ggctggatgaatgatattcttaggttttacgaagaggacccttattatcgaaaatacgat
ttcaatctcttaacctttagctttatgtattgctttaaggagcattacattttacccttc
tctcacgatgaggttgttcatggcaaaaaaagcctcatgcataaaatgtggggagaccgc
tacaatcaatttgcaggcttaagaaacctttacacttatcaaatctgccatccaggtaag
aagctgctttttatgggatctgagtttggacaatttttagaatggaaatacgaccatcaa
ttggagtggcaaaatttagaggacgagctcaatgctaaaatgcagtattttacagccagc
ttaaatcagctatataaggctcacagcatgctgtggcaaaatgatgaaacctatgatggc
attgatattattgatgcagacaataaggacgaatcagtcttgtcgttttgtcgtcaaaac
aataaaggagagctcttgctttgtgtctttaacatgacacctgttgaaagaccagacttt
accataggtgtgccaatagcaggtctttatcaagaaattttcaatacagagcttgaggcc
tttggaggtgtctggaaggagcacaatcccttaaccagcacagtagccaagaaatggaag
acttatccgcaggctttgagctttaccctgcctgcactaggagcaagcatctggaaaatc
aagcgtcgtaggaagcaataa

DBGET integrated database retrieval system