KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_12130Help
Entry
SZO_12130         CDS       T00871                                 

Definition
beta-galactosidase precursor (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:seq00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1349356..1351140)
Genome map
AA seq 594 aa AA seqDB search
MKQFCIKEQFYLDGKPFKILSGAIHYFRIAPDSWSRVLYQLKALGFNTVETYIPWNMHEP
RKGQFTFEGIADVEAFLDLAQEYGLYAIVRPSPYICAEWEFGGLPAWLLTENCRVRSSDE
VFLKHVADYYDVLLPKLVKRQLDNGGNILMFQLENEYGSYGEEKDYLRKLKELMLAKGIS
APLFTSDGPWLATLASGSLIDDDVFVTGNFGSNASKQFASMQDFFQAHQKQWPLMCMEFW
LGWFNRWNEPIIRRDPKETVDAIMEAIELGSINLYMFCGGTNFGFMNGSSARLQKDLPQI
TSYDYDALLDEAGNPTKKYILLQERLKERYPQLSFAEPMTSPTMALESIRLSAKVSLFKT
IKNVSAIKKSFYPCNMEELDQPTGYLLYRTHLARHSKEERLRVIDARDRIQLFLDEKHVK
TQYQEEIGQDILIHQEDETTQLDLLVENMGRVSYGHKLTAPSQQKGLGRGLMADLHFVGH
WEHFLLDFQELDWIDFSAGWTDGVPGFYAYDFDCQQPADTYLDLSQFGKGVALVNGVNLG
RFWKVGPTLSLYIPKGLLKQGQNRLLIFETEGQFSESIRLTKEPIYNDIKGENL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattttgcataaaggagcagttttaccttgatggcaagccgtttaagatatta
tcaggtgccattcattactttaggatagctcctgatagctggtctagggtgctttatcag
ctgaaagccttaggctttaatacagtagaaacctatattccttggaacatgcatgagcca
aggaagggacagtttacctttgaggggattgcagatgttgaggcgtttttggatttggca
caggaatatggcctatatgctattgtcagaccttcaccttatatctgtgctgaatgggaa
tttggtggtttgcctgcttggctattaactgaaaattgtcgtgtcagatcaagcgatgag
gtctttctgaagcatgtagcagattattatgatgtgttattaccaaagctggtgaagcgt
caactggataatggcggcaatattctgatgtttcagcttgaaaatgagtatggttcttat
ggtgaagaaaaggattatttaagaaaattaaaagagcttatgcttgctaaaggcattagt
gcccctcttttcacctcagatggaccttggttagccacgctagcatcaggaagtttgatt
gatgatgatgtttttgtgacaggcaactttgggtcaaacgcttcaaaacaatttgccagc
atgcaggattttttccaagcacatcaaaagcaatggcctctgatgtgtatggaattctgg
ttgggctggtttaaccgttggaatgagccaatcattcgaagggatcccaaggaaactgtt
gatgcgatcatggaggctatagaattgggcagcattaacctttatatgttttgtggtggc
actaattttggctttatgaatggctcgtcagctcgtctgcaaaaggatttaccgcagata
acctcctatgattacgacgcattactagatgaggcaggaaacccaacgaagaaatatatc
ctgctacaagaacgtctcaaggagcgttacccccaattatcctttgcagagccaatgacc
agccctacgatggctttggaatctatcaggctgtcagcaaaggttagtctttttaagaca
atcaaaaatgttagcgctatcaagaaaagtttttatccttgtaatatggaggagctagat
caaccaacgggctacctactgtataggacgcacctcgctagacatagcaaggaggaacgg
ctaagggtcattgatgctagagaccgcattcagctctttttagatgaaaagcatgtgaaa
acccagtatcaggaggaaatcggtcaggatatactgatacaccaagaagacgagaccaca
cagcttgatcttttagttgaaaatatgggacgtgtcagctatgggcacaagctaacagca
ccaagtcaacaaaaaggattaggcagaggcttaatggctgacttgcattttgtaggtcat
tgggagcattttctgctagattttcaagagctggattggattgatttttctgcaggttgg
actgatggcgtgccaggattttacgcctatgattttgattgtcagcagccggcagatacc
tatcttgatttgagtcaattcggaaaaggagttgcccttgtaaatggtgttaacctagga
cgtttttggaaggtcggtccaacattatcgctttatattcctaagggattattaaagcaa
ggtcaaaatagactgctgatatttgaaacagaagggcagtttagtgagtcaattcgttta
actaaggaaccaatttataatgatataaaaggagaaaacttatga

DBGET integrated database retrieval system