KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_12440Help
Entry
SZO_12440         CDS       T00871                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00480  Glutathione metabolism
seq00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SZO_12440
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SZO_12440
Enzymes [BR:seq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SZO_12440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAW99740
UniProt: C0MHJ4
Position
1389284..1389778
Genome map
AA seq 164 aa AA seqDB search
MTSIYDFSVKGQDGTECSLEQYQGKVLLVVNTATKCGLTPQYQALQELYDTYREQGFEIL
DFPCNQFLHQAPGNATEINAFCSLTYHTTFPRFAKIKVNGKETEPLFTWLKEQKSGPLGK
RIEWNFAKFLIDQKGQVVERYASKTDPKMIETALQRLLLQEPID
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgacttcagcgttaaggggcaagatggcactgaatgctcactggag
caataccaaggaaaggtcctattagtggtcaacaccgccactaaatgcggattaactcct
caatatcaagcattacaagagctttatgacacctacagggaacaaggctttgaaatcctt
gatttcccctgcaatcaatttttacatcaagcaccgggtaatgctacagaaatcaatgcc
ttttgcagcttaacctaccataccacctttccacgctttgccaaaattaaggttaatggc
aaggagacagagccattattcacttggctcaaggaacaaaaaagtggcccactcggcaag
cgcatcgaatggaacttcgcaaaatttttaattgatcaaaaggggcaggttgttgagcgc
tatgcctcaaaaacagacccaaaaatgattgaaacagccctacagcgattactcctccaa
gagccaattgactaa

DBGET integrated database retrieval system