KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_12440Help
Entry
SZO_12440         CDS       T00871                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:seq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:seq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389284..1389778
Genome map
AA seq 164 aa AA seqDB search
MTSIYDFSVKGQDGTECSLEQYQGKVLLVVNTATKCGLTPQYQALQELYDTYREQGFEIL
DFPCNQFLHQAPGNATEINAFCSLTYHTTFPRFAKIKVNGKETEPLFTWLKEQKSGPLGK
RIEWNFAKFLIDQKGQVVERYASKTDPKMIETALQRLLLQEPID
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgacttcagcgttaaggggcaagatggcactgaatgctcactggag
caataccaaggaaaggtcctattagtggtcaacaccgccactaaatgcggattaactcct
caatatcaagcattacaagagctttatgacacctacagggaacaaggctttgaaatcctt
gatttcccctgcaatcaatttttacatcaagcaccgggtaatgctacagaaatcaatgcc
ttttgcagcttaacctaccataccacctttccacgctttgccaaaattaaggttaatggc
aaggagacagagccattattcacttggctcaaggaacaaaaaagtggcccactcggcaag
cgcatcgaatggaacttcgcaaaatttttaattgatcaaaaggggcaggttgttgagcgc
tatgcctcaaaaacagacccaaaaatgattgaaacagccctacagcgattactcctccaa
gagccaattgactaa

DBGET integrated database retrieval system