KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_13580Help
Entry
SZO_13580         CDS       T00871                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:seq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SZO_13580
DNA repair and recombination proteins [BR:seq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SZO_13580
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SZO_13580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Pox_Rap94 DUF3874
Motif
Other DBs
NCBI-ProteinID: CAW99924
UniProt: C0MCW0
Position
complement(1524084..1524680)
Genome map
AA seq 198 aa AA seqDB search
MLYPIPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMAGEATEVIVATNATADGEATAMYISRILKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttaccctataccaatcgcaaaattaattgaaagctattctaaattaccagggatt
ggcgttaaaacagcgacaagattggctttttacaccattggaatgtctgatgaggatgtg
aatgattttgccaaaaatttattagcagctaagcgagaattaacctattgctccatctgt
ggcaatttgacagatgatgatccctgccatatttgcacagatagcagtcgggataaagag
actattttagttgttgaggcttccaaggacgtttctgctatggaaaaaattcaagaatat
catggctattaccatgtgctgcatggcttgatttctcccatgaatggggttggtccagat
gacatcaatctaaagagcctaatcacgcgtttgatggctggagaggcaacagaggtcatt
gttgcaacgaatgccacagcagatggagaggcgactgcgatgtacatttcacgtatccta
aagcctgctggtatcaaggtaacgagattggctagaggcttggcagtaggatcagacatt
gaatatgctgatgaagtgaccctgctgcgagcgattgaaaatcgaacagaattatag

DBGET integrated database retrieval system