KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_13630Help
Entry
SZO_13630         CDS       T00871                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SZO_13630 (gpmA)
   01230 Biosynthesis of amino acids
    SZO_13630 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SZO_13630 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SZO_13630 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SZO_13630 (gpmA)
Enzymes [BR:seq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SZO_13630 (gpmA)
Exosome [BR:seq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SZO_13630 (gpmA)
  Exosomal proteins of melanoma cells
   SZO_13630 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1529332..1530027)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYAHLDHSVIPDAENLKVTLERALPFWEDKIAPALVDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMNVEIPNFPPLVFEFDDKLNLTAEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgtcatggtgagtcagaatggaacaaagcaaaccttttc
actggttgggctgacgttgatttgtccgaaaagggaacacagcaggctattgatgctgga
aaattgatcaaggaagctggcattgcatttgaccttgcctttacatctgtgcttaagcgt
gctatcaagacaactaatcttgcacttgagtattctgatcagctttgggtacctgttgaa
aaatcatggcgcttgaacgagcgtcactatggtggcttgactggtaaaaacaaggcagaa
gcagctgagcaatttggtgatgagcaggttcatatctggcgccgttcatacgatgtgttg
cctcctgatatggcaaaagatgatgagcattcagcacatactgatcgtcgttacgctcat
cttgatcattctgttattccagatgcagaaaacctgaaggtaacactagagcgtgccctt
cctttctgggaagataagattgcaccagccttagttgatggtaaaaatgtttttgttgga
gcacatggtaactctattcgtgcccttgtcaaacacatcaagcaattatcagatgacgag
attatgaatgtggaaatcccgaacttcccaccgcttgtgtttgaatttgatgacaagcta
aaccttactgctgagtactacctcggtggtgaataa

DBGET integrated database retrieval system