KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_13630Help
Entry
SZO_13630         CDS       T00871                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00010  Glycolysis / Gluconeogenesis
seq00260  Glycine, serine and threonine metabolism
seq00680  Methane metabolism
seq01100  Metabolic pathways
seq01110  Biosynthesis of secondary metabolites
seq01120  Microbial metabolism in diverse environments
seq01130  Biosynthesis of antibiotics
seq01200  Carbon metabolism
seq01230  Biosynthesis of amino acids
Module
seq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SZO_13630
  Energy metabolism
   00680 Methane metabolism
    SZO_13630
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SZO_13630
Enzymes [BR:seq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SZO_13630
Membrane trafficking [BR:seq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SZO_13630
Exosome [BR:seq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SZO_13630
  Exosomal proteins of melanoma cells
   SZO_13630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAW99932
UniProt: C0MCW5
Position
complement(1529332..1530027)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYAHLDHSVIPDAENLKVTLERALPFWEDKIAPALVDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMNVEIPNFPPLVFEFDDKLNLTAEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgtcatggtgagtcagaatggaacaaagcaaaccttttc
actggttgggctgacgttgatttgtccgaaaagggaacacagcaggctattgatgctgga
aaattgatcaaggaagctggcattgcatttgaccttgcctttacatctgtgcttaagcgt
gctatcaagacaactaatcttgcacttgagtattctgatcagctttgggtacctgttgaa
aaatcatggcgcttgaacgagcgtcactatggtggcttgactggtaaaaacaaggcagaa
gcagctgagcaatttggtgatgagcaggttcatatctggcgccgttcatacgatgtgttg
cctcctgatatggcaaaagatgatgagcattcagcacatactgatcgtcgttacgctcat
cttgatcattctgttattccagatgcagaaaacctgaaggtaacactagagcgtgccctt
cctttctgggaagataagattgcaccagccttagttgatggtaaaaatgtttttgttgga
gcacatggtaactctattcgtgcccttgtcaaacacatcaagcaattatcagatgacgag
attatgaatgtggaaatcccgaacttcccaccgcttgtgtttgaatttgatgacaagcta
aaccttactgctgagtactacctcggtggtgaataa

DBGET integrated database retrieval system