KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_16460Help
Entry
SZO_16460         CDS       T00871                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:seq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SZO_16460
Enzymes [BR:seq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SZO_16460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1838859..1841258
Genome map
AA seq 799 aa AA seqDB search
MEHFFTGTVDRIIFDNASNFFKILLLAIEDTDSDFDEADIVITGTMAEIIEGEAYTFWGE
LTQHPRYGQQLRLSRYQKAKPTSAGLVSYFSSEHFKGIGQKTAEKIIALYGNNPIDEILK
NPSRLNEISSLSKANREAFVAKLKANYGTEQVIAALADLGLANRFAFQLFDKYKEEAVHI
VKDNPYQLIEDIQGFGFKLADSLAEQLGIESDSPKRFRAALLHCLLEQSIKRGDTYIQAR
ELLALTISLLEDTRPVECDPAIVANQLTQLIDEGKVMTIGTRVFDSSLYYAEDGIQKHLT
RLLQQPLTKEPSQDTIDQEIQAIQEEFAITYDKIQKQAISQALTSKVFILTGGPGTGKTT
VIRGILQAYASLYQIDLKQKDIPIILAAPTGRAARRMNELTGLASATIHRHLGLNGDNDY
QVMEDYLDCDLLIVDEFSMVDTWLANQLLTAINSNTQLIIVGDSDQLPSVGPGQVLADLL
KVDRIPHITLDKIFRQSEESTIVDLANHIRQGILAPDFCQKKADRSYFEAQAPFIPGMMT
KIVQAALKSGIPAEEIQILAPMYKGLAGINSLNQLMQNLLNPLADQTEFLFNETAFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDEIVIDFDGTEIVYPRNEWLKITLAY
AMSIHKSQGSEFQVVILPVTRQSGRLLQRNLIYTAITRSKSKLIMLGEIAAFEEAIKKEG
DKRHTYLVQRLQVAEADDHTAAASVKESNQSSLSVMPATSPQKEQEQPPYLLTPHNFLAI
DPMIGLTEDDMLTFFKKKS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttttttacaggcactgttgaccgaattatctttgacaatgcgtcaaatttt
ttcaaaattctattactggctatagaggatactgatagtgattttgatgaagctgacatt
gtcattacaggcactatggctgagatcatagagggcgaagcctataccttttggggtgag
ctgacccagcacccaaggtatggtcagcagctgcgcctgagccgctatcaaaaggctaag
cccacctcagcaggtctcgttagctatttttccagtgagcatttcaagggcattgggcaa
aaaacagctgagaaaatcattgccctttacggtaataatcctattgatgagattttaaaa
aatcccagtcggcttaatgagatctctagcctttctaaggctaatcgtgaagcctttgtg
gcaaagcttaaagccaattatggcactgagcaggtgattgctgccttggctgatctagga
ctggccaatcgctttgcctttcagctatttgacaaatacaaggaagaggctgttcatatc
gtcaaggacaatccttatcaactcattgaggacattcaaggctttggctttaagctggct
gatagcttagctgaacagctaggaattgagagtgactctcccaagcgctttcgtgcggct
ctgctgcattgcctgttggagcaatccatcaagcgaggcgacacctatatccaggcacgt
gagcttttggcgctgaccattagcctattagaggacacaaggccagtcgaatgcgaccca
gctattgtcgctaatcagctaacccagctcatcgacgagggcaaggttatgactattggc
acgcgtgtttttgacagcagcctttattatgccgaagacggcattcaaaagcatctgaca
cgcttactacagcagcctctgactaaggagcctagtcaagataccattgaccaagaaatc
caagccatacaagaggagtttgctataacctatgacaagatccaaaagcaggccatcagc
caggcactgaccagcaaggttttcattctaacaggaggcccaggcacaggaaagacaacc
gttatcaggggcattttacaggcctatgccagcctgtaccagattgacctgaaacaaaag
gatattcccattatcctagcagctccaactggtcgagccgctcgtcgtatgaacgaatta
accggtctagcaagcgcaactattcaccgccatcttgggttaaacggagacaatgattac
caagtaatggaggattatttagactgtgatttgctgattgttgatgaattttccatggtt
gatacctggctggccaatcagctattaacagccatcaattctaatacccagctgatcatc
gtaggagatagcgaccagctgccttctgtcggtcctggacaggtactagctgacttgcta
aaggttgatcggatccctcacattacccttgacaagatttttcgccaatcagaggagtca
accattgttgatttagccaaccacatacgccaaggcattcttgctcctgatttttgtcag
aaaaaggctgatcgctcctactttgaagcgcaagcgccattcattcccggcatgatgaca
aagatcgtacaggctgccctaaaaagtggcatcccagctgaggaaattcaaatcctagcc
cctatgtacaaaggactagcaggcatcaacagcctcaatcagctcatgcaaaatctcctg
aatcctctagctgatcagacagaatttctctttaacgagacggcctttcgtaagggagac
aaggtgcttcaccttgtcaatgacgcacagcttaatgtcttcaatggtgatattggctat
atcacagacctcattccagccaaatataccgaatccaagcaggacgaaatcgtcatagac
tttgatggcacagagattgtctacccaagaaatgaatggttaaaaatcacccttgcctat
gccatgagcattcacaaatctcaaggcagtgaatttcaggtggtaatcctgcctgtcacc
cgtcagagtggtcgacttctgcaaagaaacctcatctacactgccatcaccagatcaaaa
agcaagctcatcatgctcggagaaatagccgcctttgaagaggcaatcaaaaaagaaggt
gacaagcgacacacctatctcgtacaaaggcttcaagtggctgaagctgatgaccataca
gcagctgcttcagtaaaggaatcaaatcagtctagcctatctgtaatgccagctaccagc
ccacaaaaggaacaagagcagcctccttatctgctcacccctcataatttcctagctata
gaccccatgattggtctaaccgaagatgatatgttaaccttttttaagaaaaaatcataa

DBGET integrated database retrieval system