KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_17510Help
Entry
SZO_17510         CDS       T00871                                 

Gene name
hasC2
Definition
UTP--glucose-1-phosphate uridylyltransferase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SZO_17510 (hasC2)
   00052 Galactose metabolism
    SZO_17510 (hasC2)
   00500 Starch and sucrose metabolism
    SZO_17510 (hasC2)
   00520 Amino sugar and nucleotide sugar metabolism
    SZO_17510 (hasC2)
Enzymes [BR:seq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SZO_17510 (hasC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1945774..1946682
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAPQG
KAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILEKQAPGAGNEVQLTDAIDK
LNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLGKALESTQQQ
AK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcactcgcttcctgccc
gccaccaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagccctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aagcgctctatcgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctactcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaagccaaggcctttgtg
ggcaatgagccctttgtggtcatgctgggggatgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagcttattgaggattatgattgcacacacgcctcaacgatt
gcagtgatgagggtaccgcatgaggaggtttccaattatggtgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtccagatgag
gcacctagtgacttagcgattattggacgttatttgttgacgcctgagatttttgccata
ttggagaagcaggcgcctggggctggcaatgaggttcagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgccagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcactgactacatcataaagctgggtaaagcactagaaagcactcaacagcaa
gcaaaatag

DBGET integrated database retrieval system