KEGG   Staphylococcus epidermidis RP62A: SEA0002Help
Entry
SEA0002           CDS       T00229                                 

Definition
truncated IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
pSERP:complement(988..1632)
Genome map
AA seq 214 aa AA seqDB search
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTIYRWVQEYAPILYQ
IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDTEGHTLDIWLRKQRDNHSAYAFIKRL
IKQFGKPQKVVTDQAPSTKAAMAKIIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
QSINTAKNTLKGIECIYALYKKNRRSEETCGSFY
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagatataaacaatttaacaaggatgttatcactgtagccgttggctac
tatctaagatatgcattgagctatcgtgatatatctgaaatattaagagaacgtggtgta
aacgttcatcattcaacgatctaccgttgggttcaagaatatgccccaattttatatcaa
atttggaagaaaaagcataaaaaagcttattacaaatggcgtattgatgagacgtatatc
aaaataaaaggaaaatggagctatttatatcgtgccattgatacagagggacatacatta
gatatttggttgcgtaagcaacgagataatcattcagcatatgcgtttatcaaacgtctc
attaaacaatttggtaagcctcaaaaggtagttacagatcaggcaccttcaacgaaggca
gcaatggctaaaataattaaagcttttaaacttaaacctgactgtcattgtacatcgaaa
tatctgaataacctcattgagcaagatcaccgtcatattaaagtaagaaagacaagatat
caaagtatcaatacggcaaagaatactttaaaaggtattgaatgtatttacgctctatat
aaaaagaaccgtagatctgaagagacctgcggttctttttattaa

DBGET integrated database retrieval system